Tested Applications
| Positive WB detected in | HEK-293 cells, HepG2 cells, HuH-7 cells, LNCaP cells, Raji cells, Ramos cells |
| Positive IF/ICC detected in | U2OS cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
31922-1-AP targets CCDC167 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag37080 Product name: Recombinant human C6orf129 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-77 aa of BC108655 Sequence: MTKKKRENLGVALEIDGLEEKLSQCRRDLEAVNSRLHSRELSPEARRSLEKEKNSLMNKASNYEKELKFLRQENRKN Predict reactive species |
| Full Name | chromosome 6 open reading frame 129 |
| Calculated Molecular Weight | 11 kDa |
| Observed Molecular Weight | 11 kDa |
| GenBank Accession Number | BC108655 |
| Gene Symbol | C6orf129 |
| Gene ID (NCBI) | 154467 |
| RRID | AB_3670146 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q9P0B6 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Coiled-coil domain (CCD) constituents are alpha-helix motifs expressed in different types of proteins, which can function in various biological processes, including cell proliferation, migration, and signal transduction (PMID: 9171830; 17428801). The coiled-coil domain containing 167 (CCDC167, also known as HSPC265 and C6orf129) is a membrane protein highly expressed in the lymph node. It is associated with immune function, which could be a therapeutic target for breast cancer and asthma (PMID: 33461170; 31821602).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CCDC167 antibody 31922-1-AP | Download protocol |
| WB protocol for CCDC167 antibody 31922-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



