CCDC47 Polyclonal antibody, PBS Only

• 

  WB analysis using 32080-1-AP (same clone as 32080-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 32080-1-AP (CCDC47 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 32080-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 32080-1-AP (same clone as 32080-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 32080-1-AP (CCDC47 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 32080-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse cerebellum using 32080-1-AP (same clone as 32080-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 32080-1-AP (CCDC47 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 32080-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse cerebellum using 32080-1-AP (same clone as 32080-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 32080-1-AP (CCDC47 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 32080-1-PBS in a different storage buffer formulation.

CCDC47 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 32080-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

Calumin, Coiled-coil domain-containing protein 47, GK001, MSTP041, PAT complex subunit CCDC47

---

Product Information

32080-1-PBS targets CCDC47 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36570

  Product name: Recombinant human CCDC47 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 156-483 aa of BC008905

  Sequence: GKNKNSRLAQAWFNTHRELLESNFTLVGDDGTNKEATSTGKLNQENEHIYNLWCSGRVCCEGMLIQLRFLKRQDLLNVLARMMRPVSDQVQIKVTMNDEDMDTYVFAVGTRKALVRLQKEMQDLSEFCSDKPKSGAKYGLPDSLAILSEMGEVTDGMMDTKMVHFLTHYADKIESVHFSDQFSGPKIMQEEGQPLKLPDTKRTLLFTFNVPGSGNTYPKDMEALLPLMNMVIYSIDKAKKFRLNREGKQKADKNRARVEENFLKLTHVQRQEAAQSRREEKKRAEKERIMNEEDPEKQRRLEEAALRREQKKLEKKQMKMKQIKVKAM

• Full Name: coiled-coil domain containing 47
• Calculated Molecular Weight: 56 kDa
• Observed Molecular Weight: 56 kDa
• GenBank Accession Number: BC008905
• Gene Symbol: CCDC47
• Gene ID (NCBI): 57003
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q96A33
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Coiled-coil domain containing 47 (CCDC47, also known as THNS, GK001, and MSTP041) is an endoplasmic reticulum (ER) transmembrane protein involved in calcium signaling through utilization of its calcium binding-acidic luminal domain. It also interacts with the ERAD (endoplasmic reticulum-associated degradation) complex and is involved in ER stress relief (PMID: 28974366). The expression level of CCDC47 is associated with diabetic cardiomyopathy (PMID: 30140426). Its variant would cause trichohepatoneurodevelopmental syndrome (PMID: 38524542).