Tested Applications
| Positive IHC detected in | human colon cancer tissue, human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A431 cells, U2OS cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| IHC | See 1 publications below |
Product Information
20427-1-AP targets CCDC56/COA3 in IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14260 Product name: Recombinant human CCDC56 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-106 aa of BC002698 Sequence: MASSGAGDPLDSKRGEAPFAQRIDPTREKLTPEQLHSMRQAELAQWQKVLPRRRTRNIVTGLGIGALVLAIYGYTFYSISQERFLDELEDEAKAARARALARASGS Predict reactive species |
| Full Name | coiled-coil domain containing 56 |
| Calculated Molecular Weight | 106 aa, 12 kDa |
| Observed Molecular Weight | 12 kDa |
| GenBank Accession Number | BC002698 |
| Gene Symbol | CCDC56 |
| Gene ID (NCBI) | 28958 |
| RRID | AB_10695182 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9Y2R0 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Human COX assembly factor 3 (COA3), also known as CCDC56 (coiled-coil domain-containing protein 56), is a mitochondrial transmembrane protein responsible for cytochrome c oxidase (COX) protein complex assembly. CCDC56/COA3 is located on chromosome 17 (17q.21.31) and encodes an 11.7-kDa protein with predicted transmembrane and coiled-coil domains (PMID: 22610097). CCDC56/COA3 is overexpressed at both mRNA and protein levels in human NSCLC cells, mainly as a result of decreased miR-338-3p level (PMID: 36119836).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CCDC56/COA3 antibody 20427-1-AP | Download protocol |
| IHC protocol for CCDC56/COA3 antibody 20427-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |











