CCDC56/COA3 Polyclonal antibody

• 

  IHC staining of human colon cancer using 20427-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 20427-1-AP (CCDC56 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 20427-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 20427-1-AP (CCDC56 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 20427-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 20427-1-AP (CCDC56 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 20427-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 20427-1-AP (CCDC56 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of A431 using 20427-1-AP

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using CCDC56 antibody (20427-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of U2OS using 20427-1-AP

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using CCDC56 antibody (20427-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L), CL594-phalloidin (red).

CCDC56/COA3 Polyclonal Antibody for IHC, IF/ICC, ELISA

Cat No. 20427-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, IF/ICC, ELISA

Synonyms

CCDC56, Mitochondrial translation regulation assembly intermediate of cytochrome c oxidase protein of 12 kDa, HSPC009, Cytochrome c oxidase assembly factor 3 homolog, mitochondrial, Coiled-coil domain-containing protein 56

---

Tested Applications

• Positive IHC detected in: human colon cancer tissue, human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A431 cells, U2OS cells

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IHC: See 1 publications below

Product Information

20427-1-AP targets CCDC56/COA3 in IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14260

  Product name: Recombinant human CCDC56 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-106 aa of BC002698

  Sequence: MASSGAGDPLDSKRGEAPFAQRIDPTREKLTPEQLHSMRQAELAQWQKVLPRRRTRNIVTGLGIGALVLAIYGYTFYSISQERFLDELEDEAKAARARALARASGS

• Full Name: coiled-coil domain containing 56
• Calculated Molecular Weight: 106 aa, 12 kDa
• Observed Molecular Weight: 12 kDa
• GenBank Accession Number: BC002698
• Gene Symbol: CCDC56
• Gene ID (NCBI): 28958
• RRID: AB_10695182
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y2R0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Human COX assembly factor 3 (COA3), also known as CCDC56 (coiled-coil domain-containing protein 56), is a mitochondrial transmembrane protein responsible for cytochrome c oxidase (COX) protein complex assembly. CCDC56/COA3 is located on chromosome 17 (17q.21.31) and encodes an 11.7-kDa protein with predicted transmembrane and coiled-coil domains (PMID: 22610097). CCDC56/COA3 is overexpressed at both mRNA and protein levels in human NSCLC cells, mainly as a result of decreased miR-338-3p level (PMID: 36119836).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Am J Cancer Res; COA3 overexpression promotes non-small cell lung cancer metastasis by reprogramming glucose metabolism; Authors - Hongwei Lin