Tested Applications
Positive WB detected in | A549 cells, HEK-293 cells, MCF-7 cells |
Positive IP detected in | A549 cells |
Positive IHC detected in | human skin tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | A549 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:20-1:200 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 3 publications below |
IHC | See 1 publications below |
Product Information
20393-1-AP targets CCDC72 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag13792 Product name: Recombinant human CCDC72 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-64 aa of BC001102 Sequence: MSGREGGKKKPLKQPKKQAKEMDEEDKAFKQKQKEEQKKLEELKAKAAGKGPLATGGIKKSGKK Predict reactive species |
Full Name | coiled-coil domain containing 72 |
Calculated Molecular Weight | 64 kDa, 7 kDa |
Observed Molecular Weight | 7 kDa |
GenBank Accession Number | BC001102 |
Gene Symbol | CCDC72 |
Gene ID (NCBI) | 51372 |
RRID | AB_10667404 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9Y2S6 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CCDC72, also named as TMA7, is a novel modulator for hair follicle development. CCDC72 has the promoter activity and regulation of gene expression.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for CCDC72 antibody 20393-1-AP | Download protocol |
IHC protocol for CCDC72 antibody 20393-1-AP | Download protocol |
IF protocol for CCDC72 antibody 20393-1-AP | Download protocol |
IP protocol for CCDC72 antibody 20393-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Int J Biol Sci IGF2BP3 Regulates TMA7-mediated Autophagy and Cisplatin Resistance in Laryngeal Cancer via m6A RNA Methylation | ||
bioRxiv Genetic deficiency of ribosomal rescue factor HBS1L causes retinal dystrophy associated with Pelota and EDF1 depletion | ||
Dis Model Mech HBS1L deficiency causes retinal dystrophy in a child and a mouse model associated with defective development of photoreceptor cells |