CCDC72 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CCDC72 Polyclonal antibody (20393-1-AP)

CCDC72 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 20393-1-AP Copied!

Publications (3)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

Translation machinery-associated protein 7, TMA7, HSPC330, HSPC016, Coiled-coil domain-containing protein 72

• 

  WB analysis of A549 using 20393-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 20393-1-AP (CCDC72 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of MCF-7 using 20393-1-AP

  MCF7 cells were subjected to SDS PAGE followed by western blot with 20393-1-AP (CCDC72 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 20393-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 20393-1-AP (CCDC72 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of A549 using 20393-1-AP

  IP result of anti-CCDC72 (IP:20393-1-AP, 4ug; Detection:20393-1-AP 1:500) with A549 cells lysate 2400 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skin using 20393-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin using 20393-1-AP (CCDC72 antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skin using 20393-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin using 20393-1-AP (CCDC72 antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of A549 using 20393-1-AP

  Immunofluorescent analysis of (10% Formaldehyde) fixed A549 cells using 20393-1-AP (CCDC72 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CCDC72 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A549 cells, HEK-293 cells, MCF-7 cells
• Positive IP detected in: A549 cells
• Positive IHC detected in: human skin tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A549 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

20393-1-AP targets CCDC72 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13792

  Product name: Recombinant human CCDC72 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-64 aa of BC001102

  Sequence: MSGREGGKKKPLKQPKKQAKEMDEEDKAFKQKQKEEQKKLEELKAKAAGKGPLATGGIKKSGKK

• Full Name: coiled-coil domain containing 72
• Calculated Molecular Weight: 64 kDa, 7 kDa
• Observed Molecular Weight: 7 kDa
• GenBank Accession Number: BC001102
• Gene Symbol: CCDC72
• Gene ID (NCBI): 51372
• RRID: AB_10667404
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y2S6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CCDC72, also named as TMA7, is a novel modulator for hair follicle development. CCDC72 has the promoter activity and regulation of gene expression.

Publications

What published studies show

The CCDC72 (TMA7) Polyclonal Antibody (Cat# 20393-1-AP) has 3 total citations. These appear in International Journal of Biological Sciences, Disease Models & Mechanisms, and bioRxiv. Associated research fields include laryngeal cancer (autophagy regulation and cisplatin resistance via m6A RNA methylation), and retinal dystrophy (photoreceptor cell development). Applications cited are WB and IHC in human and mouse samples.

Automatically generated from the 3 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IHC	Int J Biol Sci; IGF2BP3 Regulates TMA7-mediated Autophagy and Cisplatin Resistance in Laryngeal Cancer via m6A RNA Methylation; Authors - Like Yang
mouse	WB	Dis Model Mech; HBS1L deficiency causes retinal dystrophy in a child and a mouse model associated with defective development of photoreceptor cells; Authors - Shiyu Luo
mouse	WB	bioRxiv; Genetic deficiency of ribosomal rescue factor HBS1L causes retinal dystrophy associated with Pelota and EDF1 depletion; Authors - Shiyu Luo