Tested Applications
Positive WB detected in | Daudi cells, Jurkat cells, NK-92 cells, Ramos cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
IF | See 1 publications below |
Product Information
20871-1-AP targets CCDC88B in WB, IF, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag14936 Product name: Recombinant human CCDC88B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1378-1476 aa of BC030194 Sequence: QSSLCLRDETLAGGQRRKLSSRFPVGRSSESFSPGDTPRQRFRQRHPGPLGAPVSHSKGPGVGWENSAETLQEHETDANREGPEVQEPEKRPLTPSLSQ Predict reactive species |
Full Name | coiled-coil domain containing 88B |
Calculated Molecular Weight | 1476 aa, 165 kDa |
Observed Molecular Weight | 165 kDa |
GenBank Accession Number | BC030194 |
Gene Symbol | CCDC88B |
Gene ID (NCBI) | 283234 |
RRID | AB_2935451 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | A6NC98 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for CCDC88B antibody 20871-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |