CCDC88B Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CCDC88B Polyclonal antibody (20871-1-AP)

• Featured Product
• KD/KO Validated

CCDC88B Polyclonal Antibody for WB, ELISA

Cat No. 20871-1-AP Copied!

Publications (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF, ELISA

Synonyms

Brain leucine zipper domain-containing protein, BRLZ, CCDC88, Coiled-coil domain-containing protein 88B, Gipie

• 

  WB analysis of Raji using 20871-1-AP

  Raji cells were subjected to SDS PAGE followed by western blot with 20871-1-AP (CCDC88B antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 20871-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 20871-1-AP (CCDC88B antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of NK-92 using 20871-1-AP

  WB result of CCDC88B antibody (20871-1-AP; 1:5000; incubated at room temperature for 1.5 hours) with sh-Control and sh-CCDC88B transfected NK-92 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CCDC88B in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: Daudi cells, Jurkat cells, NK-92 cells, Ramos cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

20871-1-AP targets CCDC88B in WB, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14936

  Product name: Recombinant human CCDC88B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1378-1476 aa of BC030194

  Sequence: QSSLCLRDETLAGGQRRKLSSRFPVGRSSESFSPGDTPRQRFRQRHPGPLGAPVSHSKGPGVGWENSAETLQEHETDANREGPEVQEPEKRPLTPSLSQ

• Full Name: coiled-coil domain containing 88B
• Calculated Molecular Weight: 1476 aa, 165 kDa
• Observed Molecular Weight: 165 kDa
• GenBank Accession Number: BC030194
• Gene Symbol: CCDC88B
• Gene ID (NCBI): 283234
• RRID: AB_2935451
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: A6NC98
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The CCDC88B Polyclonal antibody (Cat# 20871-1-AP) has 2 citations. One appears in Nature Communications (2025), studying noncanonical Pannexin1 function in cellular senescence and renal fibrosis post-acute kidney injury. The other is in Cell Signaling (2024), investigating TAGLN2-targeted control of ARPC5-mediated MEK/ERK signaling in pancreatic cancer proliferation, invasion, and metastasis. The cited applications include WB and IF in human samples.

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Nat Commun; Noncanonical function of Pannexin1 promotes cellular senescence and renal fibrosis post-acute kidney injury; Authors - Liuwei Huang
human	WB,IF	Cell Signal; TAGLN2 targeted control of ARPC5-mediated activation of the MEK/ERK signaling pathway influences the proliferation, invasion, and metastasis of pancreatic cancer cells; Authors - Yongjia Gao