Tested Applications
| Positive WB detected in | Daudi cells, Jurkat cells, NK-92 cells, Ramos cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below |
| IF | See 1 publications below |
Product Information
20871-1-AP targets CCDC88B in WB, IF, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14936 Product name: Recombinant human CCDC88B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1378-1476 aa of BC030194 Sequence: QSSLCLRDETLAGGQRRKLSSRFPVGRSSESFSPGDTPRQRFRQRHPGPLGAPVSHSKGPGVGWENSAETLQEHETDANREGPEVQEPEKRPLTPSLSQ Predict reactive species |
| Full Name | coiled-coil domain containing 88B |
| Calculated Molecular Weight | 1476 aa, 165 kDa |
| Observed Molecular Weight | 165 kDa |
| GenBank Accession Number | BC030194 |
| Gene Symbol | CCDC88B |
| Gene ID (NCBI) | 283234 |
| RRID | AB_2935451 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | A6NC98 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for CCDC88B antibody 20871-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Commun Noncanonical function of Pannexin1 promotes cellular senescence and renal fibrosis post-acute kidney injury | ||
Cell Signal TAGLN2 targeted control of ARPC5-mediated activation of the MEK/ERK signaling pathway influences the proliferation, invasion, and metastasis of pancreatic cancer cells |





