CCDC90B Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CCDC90B Polyclonal antibody (27126-1-AP)

CCDC90B Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 27126-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

Synonyms

MDS011, MDS025

• 

  WB analysis using 27126-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27126-1-AP (CCDC90B antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of A431 using 27126-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed A431 cells using CCDC90B antibody (27126-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of MCF-7 using 27126-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed MCF-7 cells using CCDC90B antibody (27126-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CCDC90B in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: MCF-7 cells, human placenta, mouse testis tissue, rat spleen tissue
• Positive IF/ICC detected in: MCF-7 cells, A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:12000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27126-1-AP targets CCDC90B in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25934

  Product name: Recombinant human CCDC90B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 146-246 aa of BC014573

  Sequence: IELDQVKQQLMHETSRIRADNKLDINLERSRVTDMFTDQEKQLMETTTEFTKKDTQTKSIISETSNKIDAEIASLKTLMESNKLETIRYLAASVFTCLAIA

• Full Name: coiled-coil domain containing 90B
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: BC014573
• Gene Symbol: CCDC90B
• Gene ID (NCBI): 60492
• RRID: AB_3669584
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9GZT6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CCDC90B (Coiled-coil domain-containing protein 90B) is predicted to have a single-pass transmembrane domain located at its C-terminal. As two isoforms belong to the same protein family, CCDC90A/MCUR1 and CCDC90B show similar expression levels among tissues with few exceptions.

Publications

What published studies show

The CCDC90B Polyclonal antibody (Cat# 27126-1-AP) has 1 citation to date. The publication appeared in Stem Cell Reports (IF 5.6), published in 2026. The study, "Targeting CCDC90B restores intestinal stem cell function under hyperuricemic stress," belongs to the research fields of stem cell biology and intestinal physiology under metabolic stress conditions.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Stem Cell Reports; Targeting CCDC90B restores intestinal stem cell function under hyperuricemic stress.; Authors - Xiuying Peng