Tested Applications
| Positive WB detected in | MCF-7 cells, human placenta, mouse testis tissue, rat spleen tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:12000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
27126-1-AP targets CCDC90B in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25934 Product name: Recombinant human CCDC90B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 146-246 aa of BC014573 Sequence: IELDQVKQQLMHETSRIRADNKLDINLERSRVTDMFTDQEKQLMETTTEFTKKDTQTKSIISETSNKIDAEIASLKTLMESNKLETIRYLAASVFTCLAIA Predict reactive species |
| Full Name | coiled-coil domain containing 90B |
| Observed Molecular Weight | 28 kDa |
| GenBank Accession Number | BC014573 |
| Gene Symbol | CCDC90B |
| Gene ID (NCBI) | 60492 |
| RRID | AB_3669584 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9GZT6 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CCDC90B (Coiled-coil domain-containing protein 90B) is predicted to have a single-pass transmembrane domain located at its C-terminal. As two isoforms belong to the same protein family, CCDC90A/MCUR1 and CCDC90B show similar expression levels among tissues with few exceptions.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for CCDC90B antibody 27126-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

