CCKAR Polyclonal antibody

• 

CCKAR Polyclonal Antibody for ELISA

Cat No. 18116-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

ELISA

Synonyms

CCK A, CCK A receptor, CCK AR, CCK1 R, CCKAR, CCKRA, Cholecystokinin 1 receptor, cholecystokinin A receptor

---

Product Information

18116-1-AP targets CCKAR in ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12615

  Product name: Recombinant human CCKAR protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 232-428 aa of BC074987

  Sequence: ISLELYQGIKFEASQKKSAKERKPSTTSSGKYEDSDGCYLQKTRPPRKLELRQLSTGSSSRANRIRSNSSAANLMAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTASAERRLSGTPISFILLLSYTSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGPPGARGEVGEEEEGGTTGASLSRFSYSHMSASVPPQ

• Full Name: cholecystokinin A receptor
• Calculated Molecular Weight: 428 aa, 48 kDa
• GenBank Accession Number: BC074987
• Gene Symbol: CCKAR
• Gene ID (NCBI): 886
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P32238
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.