CCL14 Fusion Protein

Source

E. coli-derived, PGEX-4T

Tag

GST

Format

Liquid

Cat no : Ag5439

Synonyms

CC-1; CC-3; CKb1; FLJ16015; HCC-1; HCC-3; MCIF; NCC-2; NCC2; SCYA14; SCYL2; SY14



Product Information

Peptide Sequence MKISVAAIPFFLLITIALGTKTESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN
(1-93 aa encoded by BC045165)
Activity Not tested.
Endotoxin Level Please contact the lab for more information.
Formulation The purified protein was resolved in 1M PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8. ) added with 100mM GSH and 15%glycerol.