CCL22/MDC Recombinant monoclonal antibody, PBS Only

CCL22/MDC Uni-rAb® Recombinant Antibody for Indirect ELISA
Cat No. 84370-1-PBS
Clone No.241668C10

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

Indirect ELISA

CCL22, MDC, C C motif chemokine 22, CC chemokine STCP-1, C-C motif chemokine 22

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84370-1-PBS targets CCL22/MDC in Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg1974

Product name: Recombinant Human CCL22 protein (rFc Tag)

Source: mammalian cells-derived, pHZ-KIsec-N-rFc

Tag: N-rFc

Domain: 25-93 aa of BC027952

Sequence: GPYGANMEDSVCCRDYVRYRLPLRVVKHFYWTSDSCPRPGVVLLTFRDKEICADPRVPWVKMILNKLSQ

Predict reactive species
Full Name chemokine (C-C motif) ligand 22
Calculated Molecular Weight 93 aa, 11 kDa
GenBank Accession NumberBC027952
Gene Symbol CCL22/MDC
Gene ID (NCBI) 6367
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO00626
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

CCL22, also known as macrophage-derived chemokine (MDC), is a member of the CC chemokine family. It is primarily produced by myeloid cells such as macrophages and dendritic cells (DCs) under steady-state conditions. CCL22 plays a significant role in immune responses by regulating the migration of different subsets of leukocytes. It shares the same receptor, CCR4, which is predominantly expressed by Th2 cells, making CCL22 a key mediator in the development of Th2-dominant diseases such as atopic dermatitis and asthma. Elevated serum levels of CCL22 are observed in patients with these conditions. CCL22 is also expressed in several types of tumor cells and Foxp3+ regulatory T cells (Tregs), suggesting its involvement in attracting Tregs into the tumor microenvironment to evade immune attacks.

Loading...
||
New chat

Able

正在加载,请稍候...