Anti-Human CCL22/MDC Rabbit Recombinant Antibody, PBS Only

• 

  FC experiment of human monocyte-derived mature dendritic cells using 98280-1-RR (same clone as 98280-1-PBS)

  1x10^6 human monocyte-derived mature dendritic cells were intracellularly stained with 0.25 ug Anti-Human CCL22 Rabbit RecAb (98280-1-RR, Clone: 241668D5) and PE-Conjugated Goat Anti-Rabbit IgG(H+L) (red), or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue). Cells were incubated with FC Receptor Block prior to staining. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 98280-1-PBS in a different storage buffer formulation.

CCL22/MDC Uni-rAb^® Recombinant Antibody for FC (Intra)

Cat No. 98280-1-PBS

Clone No.241668D5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC (Intra)

Synonyms

CCL22, MDC, 241668D5, C C motif chemokine 22, CC chemokine STCP-1

---

Product Information

98280-1-PBS targets CCL22/MDC in FC (Intra) applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1974

  Product name: Recombinant Human CCL22 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-N-rFc

  Tag: N-rFc

  Domain: 25-93 aa of BC027952

  Sequence: GPYGANMEDSVCCRDYVRYRLPLRVVKHFYWTSDSCPRPGVVLLTFRDKEICADPRVPWVKMILNKLSQ

• Full Name: chemokine (C-C motif) ligand 22
• Calculated Molecular Weight: 93 aa, 11 kDa
• GenBank Accession Number: BC027952
• Gene Symbol: CCL22/MDC
• Gene ID (NCBI): 6367
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: O00626
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The C-C motif chemokine ligand 22 (CCL22), also known as MDC, belongs to the group of chemokines, that are both constitutively expressed under homeostatic conditions and inducible upon inflammation. CCL22 is a secreted protein that exerts chemotactic activity for monocytes, dendritic cells, natural killer cells, and for chronically activated T lymphocytes. CCL22 is induced by LPS, IL-4, and IL-13 and in T cells by TCR stimulation. Accumulating studies indicate that CCL22 recruits regulatory T (T-reg) cells into tumor tissues and is expressed in many human tumors.