Anti-Mouse CCL22/MDC Rabbit Recombinant Antibody

• 

  FC experiment of Transfected HEK-293T using 98501-2-RR

  1x10^6 HEK-293T cells or CCL22/MDC transfected HEK-293T cells were intracellularly stained with 0.25 ug Anti-Mouse CCL22/MDC Rabbit RecAb (98501-2-RR, Clone: 250115D3) and APC-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

• 

  FC experiment of Transfected HEK-293T using 98501-2-RR

  1x10^6 HEK-293T cells or CCL22/MDC transfected HEK-293T cells were intracellularly stained with 0.25 ug Anti-Mouse CCL22/MDC Rabbit RecAb (98501-2-RR, Clone: 250115D3) (red) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and APC-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

• 

  Affinity and Kinetic Characterization of 98501-2-RR

  Biolayer interferometry (BLl) kinetic assays of 98501-2-RR against Mouse CCL22/MDC were performed. The affinity constant is 0.914 nM.

CCL22/MDC Uni-rAb^® Recombinant Antibody for FC (Intra)

Cat No. 98501-2-RR

Clone No.250115D3

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC (Intra)

Synonyms

Abcd1, Activated B and dendritic cell-derived, CC chemokine ABCD-1, C-C motif chemokine 22, Ccl22

---

Tested Applications

• Positive FC (Intra) detected in: Transfected HEK-293T cells

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

98501-2-RR targets CCL22/MDC in FC (Intra) applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2241

  Product name: Recombinant Mouse CCL22 protein (rFc Tag) (HPLC verified)

  Source: mammalian cells-derived, pHZ-KIsec-N-rFc

  Tag: N-rFc

  Domain: 25-92 aa of NM_009137

  Sequence: GPYGANVEDSICCQDYIRHPLPSRLVKEFFWTSKSCRKPGVVLITVKNRDICADPRQVWVKKLLHKLS

• Full Name: chemokine (C-C motif) ligand 22
• Calculated Molecular Weight: 10kd
• GenBank Accession Number: NM_009137
• Gene Symbol: CCL22/MDC
• Gene ID (NCBI): 20299
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O88430
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Background Information

The C-C motif chemokine ligand 22 (CCL22), also known as MDC, belongs to the group of chemokines, that are both constitutively expressed under homeostatic conditions and inducible upon inflammation. CCL22 is a secreted protein that exerts chemotactic activity for monocytes, dendritic cells, natural killer cells, and for chronically activated T lymphocytes. CCL22 is induced by LPS, IL-4, and IL-13 and in T cells by TCR stimulation. Accumulating studies indicate that CCL22 recruits regulatory T (T-reg) cells into tumor tissues and is expressed in many human tumors.