Product Information
18214-1-PBS targets CCL28 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag12920 Product name: Recombinant human CCL28 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-127 aa of BC069532 Sequence: MQQRGLAIVALAVCAALHASEAILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRRRICVSPHNHTVKQWMKVQAAKKNGKGNVCHRKKHHGKRNSNRAHQGKHETYGHKTPY Predict reactive species |
Full Name | chemokine (C-C motif) ligand 28 |
Calculated Molecular Weight | 127 aa, 14 kDa |
Observed Molecular Weight | 8 kDa-9 kDa |
GenBank Accession Number | BC069532 |
Gene Symbol | CCL28 |
Gene ID (NCBI) | 56477 |
RRID | AB_2262251 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9NRJ3 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |
Background Information
CCL28, also named as SCYA28, CCK1 and MEC, belongs to the intercrine beta (chemokine CC) family. It has chemotactic activity for resting CD4, CD8 T-cells and eosinophils. CCL28 binds to CCR3 and CCR10 and induces calcium mobilization in a dose-dependent manner. CCL28 is expressed in a variety of human and mouse tissues, and it appears to be predominantly produced by epithelial cells. It is produced by epithelial cells of these tissues suggesting that this chemokine can play an important role by linking homing mechanisms between the gut, nasal mucosa and mammary gland (MG). In WB test, CCL28 is 14kd and 8-9kd(a putatively to a degradation fragment).