CCL4/MIP-1 beta Polyclonal antibody

• 

  WB analysis using 26614-1-AP

  Untreated THP-1 cells, PMA, LPS, and Brefeldin A treated THP-1 cells were subjected to SDS PAGE followed by western blot with 26614-1-AP (MIP 1 beta antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Transfected HEK-293 using 26614-1-AP

  Transfected HEK-293 cells were subjected to SDS PAGE followed by western blot with 26614-1-AP (MIP 1 beta antibody at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IF Staining of THP-1 using 26614-1-AP

  Immunofluorescent analysis of (4% PFA) fixed PMA, LPS and Brefeldin A treated THP-1 cells using CCL4/MIP-1 beta antibody (26614-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

CCL4/MIP-1 beta Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 26614-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IF/ICC, ELISA

Synonyms

CCL4, MIP-1 beta, MIP-1β, ACT-2, C C motif chemokine 4

---

Tested Applications

• Positive WB detected in: PMA, LPS and Brefeldin A treated THP-1 cells, Transfected HEK-293 cells
• Positive IF/ICC detected in: PMA, LPS and Brefeldin A treated THP-1 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

26614-1-AP targets CCL4/MIP-1 beta in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25070

  Product name: Recombinant human CCL4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 24-92 aa of BC107433

  Sequence: APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN

• Full Name: chemokine (C-C motif) ligand 4
• Calculated Molecular Weight: 92 aa, 10 kDa
• Observed Molecular Weight: 10 kDa
• GenBank Accession Number: BC107433
• Gene Symbol: CCL4/MIP-1 beta
• Gene ID (NCBI): 6351
• RRID: AB_3669554
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P13236
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CCL4, also known as Macrophage inflammatory protein-1β (MIP-1β), is a CC chemokine with specificity for CCR5 receptors, and is one of the major HIV-suppressive factors produced by CD8+ T-cells. MIP-1β is an acidic protein composed of 69 amino acids that is produced by many cells, particularly macrophages, dendritic cells, and lymphocytes. MIP-1β is responsible for the activation of PMN and is involved in acute neutrophilic inflammation. Recombinant MIP-1β induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Mol Med Rep; Acute carbon monoxide poisoning induces renal inflammation and apoptosis via CCL4 upregulation and activation of the PI3K/Akt pathway in mice.; Authors - Yu Ni