Anti-Rat CCL4/MIP-1 beta Rabbit Recombinant Antibody, PBS Only

• 

  FC experiment of NR8383 using 98770-4-RR (same clone as 98770-4-PBS)

  1x10^6 untreated or LPS-treated NR8383 cells were intracellularly stained with 0.25 ug Anti-Rat CCL4/MIP-1 beta Rabbit RecAb (98770-4-RR, Clone: 251973F1) and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were fixed and permeabilized with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019). This data was developed using the same antibody clone with 98770-4-PBS in a different storage buffer formulation.

• 

  FC experiment of NR8383 using 98770-4-RR (same clone as 98770-4-PBS)

  1x10^6 LPS treated NR8383 cells were intracellularly stained with 0.25 ug Anti-Rat CCL4/MIP-1 beta Rabbit RecAb (98770-4-RR, Clone: 251973F1)(red) or Rabbit IgG Isotype Control Recombinant Antibody (98136-1-RR, Clone: 240953C9) (blue), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). 1x10^6 untreated NR8383 were surface stained with 0.25 ug Anti-Rat CCL4/MIP-1 beta Rabbit RecAb (98770-4-RR, Clone: 251973F1) and PE-Conjugated Goat Anti-Rabbit IgG(H+L) (black, dashed). Cells were fixed and permeabilized with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019). This data was developed using the same antibody clone with 98770-4-PBS in a different storage buffer formulation.

• 

  FC experiment of Transfected HEK-293T using 98770-4-RR (same clone as 98770-4-PBS)

  1x10^6 HEK-293T or CCL4/MIP-1 beta transfected HEK-293T cells were intracellularly stained with 0.25 ug Anti-Rat CCL4/MIP-1 beta Rabbit RecAb (98770-4-RR, Clone: 251973F1) and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were fixed and permeabilized with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019). This data was developed using the same antibody clone with 98770-4-PBS in a different storage buffer formulation.

• 

  FC experiment of Transfected HEK-293T using 98770-4-RR (same clone as 98770-4-PBS)

  1x10^6 HEK-293T or CCL4/MIP-1 beta transfected HEK-293T cells were intracellularly stained with 0.25 ug Anti-Rat CCL4/MIP-1 beta Rabbit RecAb (98770-4-RR, Clone: 251973F1) (red) or Rabbit IgG Isotype Control Recombinant Antibody (98136-1-RR, Clone: 240953C9) (blue), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were fixed and permeabilized with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019). This data was developed using the same antibody clone with 98770-4-PBS in a different storage buffer formulation.

CCL4/MIP-1 beta Uni-rAb^® Recombinant Antibody for FC (Intra)

Cat No. 98770-4-PBS

Clone No.251973F1

Host / Isotype

Rabbit / IgG

Reactivity

rat

Applications

FC (Intra)

Synonyms

C-C motif chemokine 4, Ccl4, CCL-4, Macrophage inflammatory protein 1-beta, MIP-1 beta

---

Product Information

98770-4-PBS targets CCL4/MIP-1 beta in FC (Intra) applications and shows reactivity with rat samples.

• Tested Reactivity: rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3200

  Product name: recombinant rat CCL4/MIP-1 beta protein

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 24-92 aa of NM_053858.1

  Sequence: APIGSDPPTSCCFSYTSRKIHRNFVMDYYETSSLCSQPAVVFLTKKGRQICADPSEPWVNEYVNDLELN

• Full Name: chemokine (C-C motif) ligand 4
• Calculated Molecular Weight: 10 kDa
• GenBank Accession Number: NM_053858.1
• Gene Symbol: Ccl4
• Gene ID (NCBI): 116637
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P50230
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CCL4, also known as Macrophage inflammatory protein-1β (MIP-1β), is a CC chemokine with specificity for CCR5 receptors, and is one of the major HIV-suppressive factors produced by CD8+ T-cells. MIP-1β is an acidic protein composed of 69 amino acids that is produced by many cells, particularly macrophages, dendritic cells, and lymphocytes. MIP-1β is responsible for the activation of PMN and is involved in acute neutrophilic inflammation. Recombinant MIP-1β induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV).