Product Information
24292-1-AP targets CCL8/MCP-2 in ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag18010 Product name: Recombinant human CCL8 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 25-99 aa of BC126242 Sequence: PDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTQRGKEVCADPKERWVRDSMKHLDQIFQNLKP Predict reactive species |
| Full Name | chemokine (C-C motif) ligand 8 |
| Calculated Molecular Weight | 99 aa, 11 kDa |
| GenBank Accession Number | BC126242 |
| Gene Symbol | CCL8/MCP-2 |
| Gene ID (NCBI) | 6355 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P80075 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
