CCM3/PDCD10 Monoclonal antibody, PBS Only

• 

  WB analysis of U-251 using 66440-1-Ig (same clone as 66440-1-PBS)

  WB result of CCM3/PDCD10 antibody (66440-1-Ig; 1:600; incubated at room temperature for 1.5 hours) with sh-Control and sh-PDCD10 transfected U-251 cells. This data was developed using the same antibody clone with 66440-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 66440-1-Ig (same clone as 66440-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 66440-1-Ig (CCM3/PDCD10 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66440-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Ramos using 66440-1-Ig (same clone as 66440-1-PBS)

  Ramos cells were subjected to SDS PAGE followed by western blot with 66440-1-Ig (CCM3/PDCD10 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66440-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human peripheral blood platelets using 66440-1-Ig (same clone as 66440-1-PBS)

  human peripheral blood platelets were subjected to SDS PAGE followed by western blot with 66440-1-Ig (CCM3/PDCD10 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66440-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 66440-1-Ig (same clone as 66440-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66440-1-Ig (CCM3/PDCD10 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66440-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 66440-1-Ig (same clone as 66440-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66440-1-Ig (PDCD10 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66440-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 66440-1-Ig (same clone as 66440-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66440-1-Ig (CCM3/PDCD10 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66440-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 66440-1-Ig (same clone as 66440-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66440-1-Ig (CCM3/PDCD10 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66440-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

CCM3/PDCD10 Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 66440-1-PBS

Clone No.1E5A8

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

CCM3, PDCD10, programmed cell death 10, TFAR15

---

Product Information

66440-1-PBS targets CCM3/PDCD10 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0348

  Product name: Recombinant human PDCD10 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 9-101 aa of BC002506

  Sequence: KNEAETTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQ

• Full Name: programmed cell death 10
• Calculated Molecular Weight: 25 kDa
• Observed Molecular Weight: 25-30 kDa
• GenBank Accession Number: BC002506
• Gene Symbol: PDCD10
• Gene ID (NCBI): 11235
• RRID: AB_2881810
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9BUL8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PDCD10, also named CCM3 and TFAR15, belongs to the PDCD10 family. PDCD10 promotes cell proliferation, increases MAPK activity and modulates apoptotic pathways. PDCD10 is important for cell migration and for normal structure and assembly of the Golgi complex. PDCD10 is required for normal angiogenesis, vasculogenesis and hematopoiesis during embryonic development, moreover, defects in PDCD10 showed abnormal cardiovascular development.