Product Information
66440-1-PBS targets CCM3/PDCD10 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag0348 Product name: Recombinant human PDCD10 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 9-101 aa of BC002506 Sequence: KNEAETTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQ Predict reactive species |
Full Name | programmed cell death 10 |
Calculated Molecular Weight | 25 kDa |
Observed Molecular Weight | 25-30 kDa |
GenBank Accession Number | BC002506 |
Gene Symbol | PDCD10 |
Gene ID (NCBI) | 11235 |
RRID | AB_2881810 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein G purification |
UNIPROT ID | Q9BUL8 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |
Background Information
PDCD10, also named CCM3 and TFAR15, belongs to the PDCD10 family. PDCD10 promotes cell proliferation, increases MAPK activity and modulates apoptotic pathways. PDCD10 is important for cell migration and for normal structure and assembly of the Golgi complex. PDCD10 is required for normal angiogenesis, vasculogenesis and hematopoiesis during embryonic development, moreover, defects in PDCD10 showed abnormal cardiovascular development.