• Featured Product
  • KD/KO Validated

Cyclin D1 Monoclonal antibody

Cyclin D1 Monoclonal Antibody for WB, FC (Intra), ELISA

Cat No. 60186-1-Ig
Clone No.2G3G5

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat and More (6)

Applications

WB, IF, FC (Intra), IP, ELISA

CCND1, 2G3G5, B cell lymphoma 1 protein, B-cell lymphoma 1 protein, BCL-1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inMCF-7 cells, A549 cells, A-673 cells, HeLa cells, NIH/3T3 cells, RAW 264.7 cells, SW480 cells, U2OS cells, A431 cells, HCT 116 cells, SK-N-SH cells, SW 1990 cells, HepG2 cells, HSC-T6 cells, PC-12 cells
Positive FC (Intra) detected inSH-SY5Y cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

60186-1-Ig targets Cyclin D1 in WB, IF, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, rabbit, chicken, zebrafish, bovine, hamster, goat
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag0689

Product name: Recombinant human Cyclin D1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 65-245 aa of BC000076

Sequence: LEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLTAEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEAEENKQIIRKHAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLNLRSPNNFLSYYRLTRFLSRVIKCDPDCLR

Predict reactive species
Full Name cyclin D1
Calculated Molecular Weight 295 aa, 34 kDa
Observed Molecular Weight 34 kDa
GenBank Accession NumberBC000076
Gene Symbol Cyclin D1
Gene ID (NCBI) 595
RRIDAB_10793718
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP24385
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CCND1 (cyclin D1), also known as PRAD1 or BCL1, belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance throughout the cell cycle. CCND1 forms a complex with and functions as a regulatory subunit of CDK4 or CDK6, whose activity is required for cell cycle G1/S transition. The CCND1 gene, located on 11q13 has been reported to be overexpressed in mantle cell lymphoma (MCL) due to the chromosomal translocation. CCND1 has been shown to interact with tumor suppressor protein Rb and the expression of this gene is regulated positively by Rb. Over-expression of CCND1 is known to correlate with the early onset of cancer and risk of tumor progression and metastasis.

Protocols

Product Specific Protocols
FC protocol for Cyclin D1 antibody 60186-1-IgDownload protocol
WB protocol for Cyclin D1 antibody 60186-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Nat Cell Biol

TRIM15 and CYLD regulate ERK activation via lysine-63-linked polyubiquitination.

Authors - Guixin Zhu
humanWB

Bioact Mater

Bioinspired engineering ADSC nanovesicles thermosensitive hydrogel enhance autophagy of dermal papilla cells for androgenetic alopecia treatment

Authors - Jiachao Xiong
humanIP

Nat Commun

F-box protein FBXO32 ubiquitinates and stabilizes D-type cyclins to drive cancer progression

Authors - Feng Li
humanWB

Mol Cancer

PMID: 32727463

Authors - Cefan Zhou
mouseWB

Adv Sci (Weinh)

Inflammatory Fibroblast-Like Synoviocyte-Derived Exosomes Aggravate Osteoarthritis via Enhancing Macrophage Glycolysis

Authors - Bin Liu
mouseWB

Acta Pharm Sin B

The substitution of SERCA2 redox cysteine 674 promotes pulmonary vascular remodeling by activating IRE1α/XBP1s pathway.

Authors - Weimin Yu

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Wissem (Verified Customer) (02-03-2026)

Antibody worked very well to detect cyclin D in extracts with no detectable non-specific bands

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:5,000
  • Cell Tissue Type: U2OS cells
Cyclin D1 Antibody Western Blot validation (1:5,000 dilution) in U2OS cells (Cat no:60186-1-Ig)
FH

Janardhan (Verified Customer) (08-22-2020)

Antibody works ok, needs longer exposure

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Medulloblastoma
FH

Yuan (Verified Customer) (01-23-2020)

The antibody is ok. Signal is not very strong for western blot. Needed relative long exposure for Hela cells.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: Hela cell
FH

Kyosuke (Verified Customer) (06-12-2019)

I use this as a proliferation marker and this antibody works very well for WB.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1/1000
  • Cell Tissue Type: rat aortic smooth muscle cells
Loading...
||
New chat

Able

正在加载,请稍候...