Tested Applications
| Positive WB detected in | HT-29 cells, NIH/3T3 cells, mouse heart tissue, HeLa cells, Jurkat cells, human lung tissue, MCF-7 cells, HepG2 cells, K-562 cells, human placenta tissue |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | mouse testis tissue, human placenta tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive FC (Intra) detected in | HeLa cells, MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:400-1:1600 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 3 publications below |
| WB | See 357 publications below |
| IHC | See 15 publications below |
| IF | See 1 publications below |
| CoIP | See 1 publications below |
Product Information
11554-1-AP targets Cyclin E1 in WB, IHC, IF, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat, pig, zebrafish, artemia sinica |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2110 Product name: Recombinant human Cyclin E protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 111-410 aa of BC035498 Sequence: ANREEVWKIMLNKEKTYLRDQHFLEQHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMATQENVVKTLLQLIGISSLFIAAKLEEIYPPKLHQFAYVTDGACSGDEILTMELMIMKALKWRLSPLTIVSWLNVYMQVAYLNDLHEVLLPQYPQQIFIQIAELLDLCVLDVDCLEFPYGILAASALYHFSSSELMQKVSGYQWCDIENCVKWMVPFAMVIRETGSSKLKHFRGVADEDAHNIQTHRDSLDLLDKARAKKAMLSEQNRASPLPSGLLTPPQSGKKQSSGPEMA Predict reactive species |
| Full Name | cyclin E1 |
| Calculated Molecular Weight | 410 aa, 47 kDa |
| Observed Molecular Weight | 47 kDa |
| GenBank Accession Number | BC035498 |
| Gene Symbol | Cyclin E1 |
| Gene ID (NCBI) | 898 |
| RRID | AB_2071066 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P24864 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Cyclin E1 (CCNE1) is a member of the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. CCNE1, an essential cyclin activating Cdk2, regulates the G1-S phase transition of the mammalian cell division cycle. Its timing expression plays a direct role in the initiation of DNA replication , the control of histone biosynthesis, and the centrosome cycle. CCNE1 is associated with disease progression in various malignancies and is associated clinically with poor prognosis. Two bands of Cyclin E1 were expressed in U2OS and MDA-MB-231 cells (PMID:9858585, PMID: 24112607).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for Cyclin E1 antibody 11554-1-AP | Download protocol |
| IHC protocol for Cyclin E1 antibody 11554-1-AP | Download protocol |
| IP protocol for Cyclin E1 antibody 11554-1-AP | Download protocol |
| WB protocol for Cyclin E1 antibody 11554-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Mol Cancer LncRNA TROJAN promotes proliferation and resistance to CDK4/6 inhibitor via CDK2 transcriptional activation in ER+ breast cancer. | ||
Adv Sci (Weinh) Identification of PRDX5 as A Target for The Treatment of Castration-Resistant Prostate Cancer | ||
Theranostics Polycomb repressive complex 1 modulates granulosa cell proliferation in early folliculogenesis to support female reproduction | ||
Nat Commun Iron-dependent histone 3 lysine 9 demethylation controls B cell proliferation and humoral immune responses. | ||
Nat Commun Identification of predictors of drug sensitivity using patient-derived models of esophageal squamous cell carcinoma. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Tsimafei (Verified Customer) (08-04-2024) | Antibody detect a weak band around 50kDa, however the signal is weak and non-specific strong signal is present at ~75kDa
![]() |
FH Carly (Verified Customer) (11-17-2020) | Tested using EDTA plasma on an antibody microarray
|




































