• Featured Product
  • KD/KO Validated

Cyclin E1 Polyclonal antibody

Cyclin E1 Polyclonal Antibody for WB, IHC, FC (Intra), IP, ELISA

Cat No. 11554-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (4)

Applications

WB, IHC, IF, FC (Intra), IP, CoIP, ELISA

CCNE1, CCNE, Cyclin E, G1/S specific cyclin E1, G1/S-specific cyclin-E1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHT-29 cells, NIH/3T3 cells, mouse heart tissue, HeLa cells, Jurkat cells, human lung tissue, MCF-7 cells, HepG2 cells, K-562 cells, human placenta tissue
Positive IP detected inHeLa cells
Positive IHC detected inmouse testis tissue, human placenta tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inHeLa cells, MCF-7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:400-1:1600
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11554-1-AP targets Cyclin E1 in WB, IHC, IF, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, rat, pig, zebrafish, artemia sinica
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2110

Product name: Recombinant human Cyclin E protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 111-410 aa of BC035498

Sequence: ANREEVWKIMLNKEKTYLRDQHFLEQHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMATQENVVKTLLQLIGISSLFIAAKLEEIYPPKLHQFAYVTDGACSGDEILTMELMIMKALKWRLSPLTIVSWLNVYMQVAYLNDLHEVLLPQYPQQIFIQIAELLDLCVLDVDCLEFPYGILAASALYHFSSSELMQKVSGYQWCDIENCVKWMVPFAMVIRETGSSKLKHFRGVADEDAHNIQTHRDSLDLLDKARAKKAMLSEQNRASPLPSGLLTPPQSGKKQSSGPEMA

Predict reactive species
Full Name cyclin E1
Calculated Molecular Weight 410 aa, 47 kDa
Observed Molecular Weight 47 kDa
GenBank Accession NumberBC035498
Gene Symbol Cyclin E1
Gene ID (NCBI) 898
RRIDAB_2071066
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP24864
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cyclin E1 (CCNE1) is a member of the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. CCNE1, an essential cyclin activating Cdk2, regulates the G1-S phase transition of the mammalian cell division cycle. Its timing expression plays a direct role in the initiation of DNA replication , the control of histone biosynthesis, and the centrosome cycle. CCNE1 is associated with disease progression in various malignancies and is associated clinically with poor prognosis. Two bands of Cyclin E1 were expressed in U2OS and MDA-MB-231 cells (PMID:9858585, PMID: 24112607).

Protocols

Product Specific Protocols
FC protocol for Cyclin E1 antibody 11554-1-APDownload protocol
IHC protocol for Cyclin E1 antibody 11554-1-APDownload protocol
IP protocol for Cyclin E1 antibody 11554-1-APDownload protocol
WB protocol for Cyclin E1 antibody 11554-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Nat Commun

Foxk1 and Foxk2 promote cardiomyocyte proliferation and heart regeneration

Authors - Dongcheng Cai
humanWB

Mol Cancer

LncRNA TROJAN promotes proliferation and resistance to CDK4/6 inhibitor via CDK2 transcriptional activation in ER+ breast cancer.

Authors - Xi Jin
humanWB

Adv Sci (Weinh)

Identification of PRDX5 as A Target for The Treatment of Castration-Resistant Prostate Cancer

Authors - Rong Wang
mouseIHC

Theranostics

Polycomb repressive complex 1 modulates granulosa cell proliferation in early folliculogenesis to support female reproduction

Authors - Meng Gao
mouseWB

Nat Commun

Iron-dependent histone 3 lysine 9 demethylation controls B cell proliferation and humoral immune responses.

Authors - Yuhang Jiang
humanWB

Nat Commun

Identification of predictors of drug sensitivity using patient-derived models of esophageal squamous cell carcinoma.

Authors - Dan Su

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Tsimafei (Verified Customer) (08-04-2024)

Antibody detect a weak band around 50kDa, however the signal is weak and non-specific strong signal is present at ~75kDa

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: mESCs
Cyclin E1 Antibody Western Blot validation (1:1000 dilution) in mESCs (Cat no:11554-1-AP)
FH

Carly (Verified Customer) (11-17-2020)

Tested using EDTA plasma on an antibody microarray

  • Applications: Other
Loading...
||
New chat

Able

正在加载,请稍候...