Tested Applications
| Positive WB detected in | HaCaT cells, K-562 cells, THP-1 cells |
| Positive IF/ICC detected in | THP-1 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 2 publications below |
Product Information
30420-1-AP targets CCR2 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag33071 Product name: Recombinant human CCR2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-42 aa of BC074751 Sequence: MLSTSRSRFIRNTNESGEEVTTFFDYDYGAPCHKFDVKQIGA Predict reactive species |
| Full Name | chemokine (C-C motif) receptor 2 |
| Calculated Molecular Weight | 374 aa, 42 kDa |
| Observed Molecular Weight | 70 kDa |
| GenBank Accession Number | BC074751 |
| Gene Symbol | CCR2 |
| Gene ID (NCBI) | 729230 |
| RRID | AB_3669721 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P41597 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CCR2 (C-C motif chemokine receptor-2), is a 42-kDa transmembrane protein highly expressed in bone marrow and lymph nodes (PMID: 16150057). It belongs to the G-protein-coupled seven-transmembrane receptor superfamily. CCR2 is the key functional receptor for MCP-1 (Monocyte chemoattractant protein-1) (PMID: 8146186). CCR2 and monocyte chemoattractant proteins (MCPs) play pivotal roles in the development of inflammatory responses and are crucial for the recruitment of immune cells to sites of inflammation. (PMID: 19441905). This antibody recognizes a homodimer consisting of its isoform1 and isoform2 (70 kDa).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CCR2 antibody 30420-1-AP | Download protocol |
| WB protocol for CCR2 antibody 30420-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
J Adv Res Novel function of macrophage migration inhibitory factor in regulating post-infarct inflammation and the therapeutic significance | ||
Chem Res Toxicol RNA Methylation and Transcriptome Analysis Reveal Key Regulatory Pathways Related to Cadmium-Induced Liver Damage |



