CCR3 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CCR3 Polyclonal antibody (22351-1-AP)

CCR3 Polyclonal Antibody for IHC, ELISA

Cat No. 22351-1-AP Copied!

Publications (4)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

IHC, IF, ELISA

Synonyms

C C chemokine receptor type 3, C C CKR 3, CC CKR 3, CCR 3, CCR3, CD193, CKR3, CMKBR3, Eosinophil eotaxin receptor

• 

  IHC staining of human tonsillitis using 22351-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 22351-1-AP (CCR3 Antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 22351-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 22351-1-AP (CCR3 Antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 22351-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 22351-1-AP (CCR3 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 22351-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 22351-1-AP (CCR3 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lymphoma using 22351-1-AP

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 22351-1-AP (CCR3 Antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lymphoma using 22351-1-AP

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 22351-1-AP (CCR3 Antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CCR3 in ?

Chat with Able

---

Tested Applications

• Positive IHC detected in: human tonsillitis tissue, human lymphoma tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:100-1:400

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

22351-1-AP targets CCR3 in IHC, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17926

  Product name: Recombinant human CCR3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 310-354 aa of BC110297

  Sequence: KYLRHFFHRHLLMHLGRYIPFLPSEKLERTSSVSPSTAEPELSIV

• Full Name: chemokine (C-C motif) receptor 3
• Calculated Molecular Weight: 355 aa, 41 kDa
• GenBank Accession Number: BC110297
• Gene Symbol: CCR3
• Gene ID (NCBI): 1232
• RRID: AB_2879085
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: P51677
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The CCR3 polyclonal antibody (Cat# 22351-1-AP) has 4 citations published in Theranostics, International Immunopharmacology, Scientific Reports, and Oncology Reports. The associated research fields include vascular biology and transplant immunology (allograft neointimal lesions), dermatology (atopic dermatitis), otolaryngology (chronic rhinosinusitis), and oncology/immunotherapy (bladder cancer and mast cell infiltration). Applications cited are primarily IHC and IF in human and mouse samples.

Automatically generated from the 4 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	Theranostics; CD34+ PI16+ fibroblast progenitors aggravate neointimal lesions of allograft arteries via CCL11/CCR3-PI3K/AKT pathway; Authors - Xiaodong Xu
mouse	IHC	Int Immunopharmacol; Emu oil alleviates atopic dermatitis-like responses by inhibiting Cdc42 signaling of keratinocyte; Authors - Lingwei Bu
human	IHC	Sci Rep; Immuno-transcriptomic analysis based on machine learning identifies immunity signature genes of chronic rhinosinusitis with nasal polyps; Authors - Zhaonan Xu
human,mouse	IHC	Oncol Rep; SYNPO2 promotes the development of BLCA by upregulating the infiltration of resting mast cells and increasing the resistance to immunotherapy; Authors - Gongjie Ye