Tested Applications
Positive IHC detected in | human tonsillitis tissue, human lymphoma tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Immunohistochemistry (IHC) | IHC : 1:100-1:400 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
IHC | See 2 publications below |
IF | See 1 publications below |
Product Information
22351-1-AP targets CCR3 in IHC, IF, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag17926 Product name: Recombinant human CCR3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 310-354 aa of BC110297 Sequence: KYLRHFFHRHLLMHLGRYIPFLPSEKLERTSSVSPSTAEPELSIV Predict reactive species |
Full Name | chemokine (C-C motif) receptor 3 |
Calculated Molecular Weight | 355 aa, 41 kDa |
GenBank Accession Number | BC110297 |
Gene Symbol | CCR3 |
Gene ID (NCBI) | 1232 |
RRID | AB_2879085 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen Affinity purified |
UNIPROT ID | P51677 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
IHC protocol for CCR3 antibody 22351-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Int Immunopharmacol Emu oil alleviates atopic dermatitis-like responses by inhibiting Cdc42 signaling of keratinocyte | ||
Theranostics CD34+ PI16+ fibroblast progenitors aggravate neointimal lesions of allograft arteries via CCL11/CCR3-PI3K/AKT pathway | ||
Oncol Rep SYNPO2 promotes the development of BLCA by upregulating the infiltration of resting mast cells and increasing the resistance to immunotherapy |