Recombinant human CCR6 protein
Source
e coli.-derived, PGEX-4T
Tag
GST
Format
Liquid
Cat no : Ag24185
Synonyms
CCR6, BN 1, C C chemokine receptor type 6, C C CKR 6, C-C chemokine receptor type 6
Validation Data Gallery View All
Product Information
| Peptide Sequence |
MSGESMNFSDVFDSSEDYFVSVNTSYYSVDSEMLLCSLQEVRQFSRL
(1-47 aa encoded by BC037960) |
| Activity | Not tested. |
| Endotoxin Level | Please contact the lab for more information. |
