CCZ1 Polyclonal antibody, PBS Only

• 

  WB analysis of NIH/3T3 using 22159-1-AP (same clone as 22159-1-PBS)

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 22159-1-AP (CCZ1 antibody at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22159-1-PBS in a different storage buffer formulation.

• 

  IP experiment of NIH/3T3 using 22159-1-AP (same clone as 22159-1-PBS)

  IP result of anti-CCZ1 (IP:22159-1-AP, 4ug; Detection:22159-1-AP 1:500) with NIH/3T3 cells lysate 1500ug. This data was developed using the same antibody clone with 22159-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 22159-1-AP (same clone as 22159-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 22159-1-AP (CCZ1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22159-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 22159-1-AP (same clone as 22159-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 22159-1-AP (CCZ1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22159-1-PBS in a different storage buffer formulation.

CCZ1 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 22159-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

---

Product Information

22159-1-PBS targets CCZ1 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17804

  Product name: Recombinant human C7orf28A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 133-482 aa of BC132749

  Sequence: VYSSVLRQCYSMYKLFNGTFLKAMEDGGVKLLKERLEKFFHRYLQTLHLQSCDLLDIFGGISFFPLDKMTYLKIQSFINRMEESLNIVKYTAFLYNDQLIWSGLEQDDMRILYKYLTTSLFPRHIEPELAGRDSPIRAEMPGNLQHYGRFLTGPLNLNDPDAKCRFPKIFVNTDDTYEELHLIVYKAMSAAVCFMIDASVHPTLDFCRRLDSIVGPQLTVLASDICEQFNINKRMSGSEKEPQFKFIYFNHMNLAEKSTVHMRKTPSVSLTSVHPDLMKILGDINSDFTRVDEDEEIIVKAMSDYWVVGKKSDRRELYVILNQKNANLIEVNEEVKKLCATQFNNIFFLD

• Full Name: chromosome 7 open reading frame 28A
• Calculated Molecular Weight: 482 aa, 56 kDa
• Observed Molecular Weight: 50-56 kDa
• GenBank Accession Number: BC132749
• Gene Symbol: CCZ1
• Gene ID (NCBI): 51622
• RRID: AB_2879011
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P86790
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.