CCZ1 Polyclonal antibody

• 

  WB analysis of NIH/3T3 using 22159-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 22159-1-AP (CCZ1 antibody at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of NIH/3T3 using 22159-1-AP

  IP result of anti-CCZ1 (IP:22159-1-AP, 4ug; Detection:22159-1-AP 1:500) with NIH/3T3 cells lysate 1500ug.

• 

  IHC staining of mouse liver using 22159-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 22159-1-AP (CCZ1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse liver using 22159-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 22159-1-AP (CCZ1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

CCZ1 Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 22159-1-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IP, ELISA

Synonyms

C7orf28A, C7orf28B, CCZ1, CGI 43, H_DJ1163J12.2, UPF0550 protein C7orf28

---

Tested Applications

• Positive WB detected in: NIH/3T3 cells
• Positive IP detected in: NIH/3T3 cells
• Positive IHC detected in: mouse liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 4 publications below

Product Information

22159-1-AP targets CCZ1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, zebrafish
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17804

  Product name: Recombinant human C7orf28A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 133-482 aa of BC132749

  Sequence: VYSSVLRQCYSMYKLFNGTFLKAMEDGGVKLLKERLEKFFHRYLQTLHLQSCDLLDIFGGISFFPLDKMTYLKIQSFINRMEESLNIVKYTAFLYNDQLIWSGLEQDDMRILYKYLTTSLFPRHIEPELAGRDSPIRAEMPGNLQHYGRFLTGPLNLNDPDAKCRFPKIFVNTDDTYEELHLIVYKAMSAAVCFMIDASVHPTLDFCRRLDSIVGPQLTVLASDICEQFNINKRMSGSEKEPQFKFIYFNHMNLAEKSTVHMRKTPSVSLTSVHPDLMKILGDINSDFTRVDEDEEIIVKAMSDYWVVGKKSDRRELYVILNQKNANLIEVNEEVKKLCATQFNNIFFLD

• Full Name: chromosome 7 open reading frame 28A
• Calculated Molecular Weight: 482 aa, 56 kDa
• Observed Molecular Weight: 50-56 kDa
• GenBank Accession Number: BC132749
• Gene Symbol: CCZ1
• Gene ID (NCBI): 51622
• RRID: AB_2879011
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P86790
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	J Neuroinflammation; Autophagy protein NRBF2 attenuates endoplasmic reticulum stress-associated neuroinflammation and oxidative stress via promoting autophagosome maturation by interacting with Rab7 after SAH.; Authors - Hanhai Zeng
human	WB	Biomedicines; CCZ1 Accelerates the Progression of Cervical Squamous Cell Carcinoma by Promoting MMP2/MMP17 Expression; Authors - Jing Yu ; KD Validated
human		Autophagy; GORASP2 promotes phagophore closure and autophagosome maturation into autolysosomes; Authors - Yusheng Xing
human	WB	Nat Commun; Endosomal trafficking participates in lipid droplet catabolism to maintain lipid homeostasis; Authors - Wang Peng ; KD Validated
zebrafish	WB	FASEB J; ATP7A Maintains Bactericidal Function of Neutrophils and Macrophages via Regulating the Formation and Activation of Phagolysosomes; Authors - YuanYuan Jing