CD14 Monoclonal antibody

• 

  WB analysis using 60253-1-Ig

  Untreated and PNGase F-treated lysates of human milk were subjected to SDS PAGE followed by western blot with 60253-1-Ig (CD14 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of THP-1 using 60253-1-Ig

  THP-1 cells were subjected to SDS PAGE followed by western blot with 60253-1-Ig (CD14 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human placenta using 60253-1-Ig

  human placenta tissue were subjected to SDS PAGE followed by western blot with 60253-1-Ig (CD14 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of RAW 264.7 using 60253-1-Ig

  RAW264.7 cells were subjected to SDS PAGE followed by western blot with 60253-1-Ig (CD14 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human tonsillitis using 60253-1-Ig

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 60253-1-Ig (CD14 antibody) at dilution of 1:2000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 60253-1-Ig

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 60253-1-Ig (CD14 antibody) at dilution of 1:2000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of human tonsillitis using 60253-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed human tonsillitis tissue using CD14 antibody (60253-1-Ig, Clone: 2C1D9 ) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

• 

  IF Staining of RAW 264.7 using 60253-1-Ig

  Immunofluorescent analysis of RAW 264.7 cells using 60253-1-Ig (CD14 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Mouse IgG (H+L).

CD14 Monoclonal Antibody for WB, IHC, IF/ICC, IF-P, ELISA

Cat No. 60253-1-Ig

Clone No.2C1D9

Publications(20)

Reviews (3)

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF/ICC, IF-P, ELISA

Synonyms

Myeloid cell-specific leucine-rich glycoprotein, Monocyte differentiation antigen CD14, urinary form, Monocyte differentiation antigen CD14, membrane-bound form, CD14 molecule, 2C1D9

---

Tested Applications

• Positive WB detected in: THP-1 cells, human milk, human placenta tissue, RAW 264.7 cells
• Positive IHC detected in: human tonsillitis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: human tonsillitis tissue
• Positive IF/ICC detected in: RAW 264.7 cells, human tonsillitis tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:1000-1:4000
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 6 publications below
• IHC: See 6 publications below
• IF: See 7 publications below
• FC: See 1 publications below

Product Information

60253-1-Ig targets CD14 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rabbit
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10693

  Product name: Recombinant human CD14 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-375 aa of BC010507

  Sequence: MERASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACARSTLSVGVSGTLVLLQGARGFA

• Full Name: CD14 molecule
• Calculated Molecular Weight: 375 aa, 40 kDa
• Observed Molecular Weight: 45-55 kDa
• GenBank Accession Number: BC010507
• Gene Symbol: CD14
• Gene ID (NCBI): 929
• ENSEMBL Gene ID: ENSG00000170458
• RRID: AB_2881374
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P08571
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD14 is a 50-55 kDa glycosylphosphatidylinositol-anchored glycoprotein preferentially expressed on monocytes and macrophages, and at lower levels on granulocytes (PMID: 3385210; 2462937; 7685797). CD14 can also exist as a soluble protein. CD14 acts as a co-receptor for bacterial liposaccharides (LPS) (PMID: 1698311). It plays a major role in the inflammatory response of monocytes to LPS.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Mol Cell; Lactylation-driven METTL3-mediated RNA m6A modification promotes immunosuppression of tumor-infiltrating myeloid cells.; Authors - Jia Xiong
human	IF	Arthritis Rheumatol; Attenuation of rheumatoid arthritis through the inhibition of caspase3/GSDME-mediated pyroptosis induced by TNF-α.; Authors - Zeqing Zhai
rabbit	IF	Bioact Mater; Novel magnetic silk fibroin scaffolds with delayed degradation for potential long-distance vascular repair.; Authors - Xin Liu
mouse	WB,IF	Sci Rep; High-Throughput Sequencing and Co-Expression Network Analysis of lncRNAs and mRNAs in Early Brain Injury Following Experimental Subarachnoid Haemorrhage.; Authors - Jianhua Peng
mouse		Front Pharmacol; Achyranthes bidentata Polysaccharide Activates Nuclear Factor-Kappa B and Promotes Cytokine Production in J774A.1 Cells Through TLR4/MyD88 Signaling Pathway; Authors - Sairong Fan
human	IHC	J Cancer; MMP9 and IGFBP1 Regulate Tumor Immune and Drive Tumor Progression in Clear Cell Renal Cell Carcinoma.; Authors - Tianbo Xu

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Sareena (Verified Customer) (06-06-2023)

Works well when conjugated to fluorophores and tested with compensation beads

• Applications: Immunofluorescence, Flow Cytometry
• Primary Antibody Dilution: CD14 Monoclonal antibody

FH

Sunil (Verified Customer) (05-15-2023)

Great and fast delivery which is always useful!

• Applications: Flow Cytometry

FH

Emma (Verified Customer) (11-29-2021)

Works well by IF on FFPE tissue. Tris-EDTA antigen retrieval pH 9.0.

• Applications: Immunofluorescence
• Primary Antibody Dilution: 1:50
• Cell Tissue Type: Prostate

CD14 Antibody Immunofluorescence validation (1:50 dilution) in Prostate (Cat no:60253-1-Ig)