CD14 Monoclonal antibody, PBS Only (Capture)

CD14 Monoclonal Antibody for WB, IHC, IF/ICC, IF-P, Cytometric bead array, Indirect ELISA

Cat No. 60253-1-PBS
Clone No.2C1D9

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IF-P, Cytometric bead array, Indirect ELISA

2C1D9, CD14 molecule, Monocyte differentiation antigen CD14, membrane-bound form, Monocyte differentiation antigen CD14, urinary form, Myeloid cell-specific leucine-rich glycoprotein

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

60253-1-PBS targets CD14 as part of a matched antibody pair:

MP50282-2: 60253-1-PBS capture and 60253-2-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag10693

Product name: Recombinant human CD14 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-375 aa of BC010507

Sequence: MERASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACARSTLSVGVSGTLVLLQGARGFA

Predict reactive species
Full Name CD14 molecule
Calculated Molecular Weight 375 aa, 40 kDa
Observed Molecular Weight 45-55 kDa
GenBank Accession NumberBC010507
Gene Symbol CD14
Gene ID (NCBI) 929
ENSEMBL Gene IDENSG00000170458
RRIDAB_2881374
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP08571
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

CD14 is a 50-55 kDa glycosylphosphatidylinositol-anchored glycoprotein preferentially expressed on monocytes and macrophages, and at lower levels on granulocytes (PMID: 3385210; 2462937; 7685797). CD14 can also exist as a soluble protein. CD14 acts as a co-receptor for bacterial liposaccharides (LPS) (PMID: 1698311). It plays a major role in the inflammatory response of monocytes to LPS.

Loading...
||
New chat

Able

正在加载,请稍候...