CD151 Polyclonal antibody, PBS Only

CD151 Polyclonal Antibody for WB, IHC, Indirect ELISA
Cat No. 27816-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

CD151 antigen, GP27, Membrane glycoprotein SFA 1, Membrane glycoprotein SFA-1, MER2

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

27816-1-PBS targets CD151 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag25968

Product name: Recombinant human CD151 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 113-221 aa of BC001374

Sequence: AYYQQLNTELKENLKDTMTKRYHQPGHEAVTSAVDQLQQEFHCCGSNNSQDWRDSEWIRSQEAGGRVVPDSCCKTVVALCGQRDHASNIYKVEGGCITKLETFIQEHLR

Predict reactive species
Full Name CD151 molecule (Raph blood group)
Calculated Molecular Weight 28 kDa
Observed Molecular Weight30 kDa
GenBank Accession NumberBC001374
Gene Symbol CD151
Gene ID (NCBI) 977
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP48509
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

CD151 (also known as TSPAN24) is a membrane protein of the tetraspanin superfamily, which are characterized by the presence of four conserved transmembrane regions. Many of these members are involved in the regulation of cell development, activation, growth and motility. CD151 is broadly expressed by a variety of cell types. It is involved in cellular processes including cell adhesion and may regulate integrin trafficking and/or function. CD151 enhances cell motility, invasion and metastasis of cancer cells.

Loading...
||
New chat Able
正在加载,请稍候...