CD151 Polyclonal antibody

• 

  WB analysis using 27816-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27816-1-AP (CD151 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 27816-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27816-1-AP (CD151 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human ovary tumor using 27816-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 27816-1-AP (CD151 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human ovary tumor using 27816-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 27816-1-AP (CD151 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human stomach cancer using 27816-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 27816-1-AP (CD151 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human stomach cancer using 27816-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 27816-1-AP (CD151 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

CD151 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 27816-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

CD151 antigen, GP27, Membrane glycoprotein SFA 1, Membrane glycoprotein SFA-1, MER2

---

Tested Applications

• Positive WB detected in: unboiled A431 cells, mouse heart tissue, unboiled A549 cells, rat heart tissue
• Positive IHC detected in: human ovary tumor tissue, human stomach cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IHC: See 1 publications below

Product Information

27816-1-AP targets CD151 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25968

  Product name: Recombinant human CD151 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 113-221 aa of BC001374

  Sequence: AYYQQLNTELKENLKDTMTKRYHQPGHEAVTSAVDQLQQEFHCCGSNNSQDWRDSEWIRSQEAGGRVVPDSCCKTVVALCGQRDHASNIYKVEGGCITKLETFIQEHLR

• Full Name: CD151 molecule (Raph blood group)
• Calculated Molecular Weight: 28 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC001374
• Gene Symbol: CD151
• Gene ID (NCBI): 977
• RRID: AB_2923579
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P48509
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD151 (also known as TSPAN24) is a membrane protein of the tetraspanin superfamily, which are characterized by the presence of four conserved transmembrane regions. Many of these members are involved in the regulation of cell development, activation, growth and motility. CD151 is broadly expressed by a variety of cell types. It is involved in cellular processes including cell adhesion and may regulate integrin trafficking and/or function. CD151 enhances cell motility, invasion and metastasis of cancer cells.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IHC	Sci Rep; Combined knockdown of CD151 and MMP9 may inhibit the malignant biological behaviours of triple-negative breast cancer through the GSK-3β/β-catenin-related pathway; Authors - Fan Li