Product Information
68897-1-PBS targets CD16 as part of a matched antibody pair:
MP50298-1: 66779-2-PBS capture and 68897-1-PBS detection (validated in Cytometric bead array)
MP50298-2: 66779-3-PBS capture and 68897-1-PBS detection (validated in Cytometric bead array)
Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | human | 
| Host / Isotype | Mouse / IgG1 | 
| Class | Monoclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Eg31662 Product name: Recombinant Human FCGR3A/CD16a (F176V) protein (Myc Tag, His Tag) Source: mammalian cells-derived, pHZ-KIsec Tag: Myc & 6*His Domain: 17-208 aa of BC017865 Sequence: GMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISSFFPPGYQ Predict reactive species | 
                                    
| Full Name | Fc fragment of IgG, low affinity IIIa, receptor (CD16a) | 
| Calculated Molecular Weight | 254 aa, 29 kDa | 
| GenBank Accession Number | BC017865 | 
| Gene Symbol | CD16a | 
| Gene ID (NCBI) | 2214 | 
| ENSEMBL Gene ID | ENSG00000203747 | 
| Conjugate | Unconjugated | 
| Form | Liquid | 
| Purification Method | Protein G purification | 
| UNIPROT ID | P08637 | 
| Storage Buffer | PBS only, pH 7.3. | 
| Storage Conditions | Store at -80°C. | 









