Anti-Mouse CD16/CD32 Rabbit Recombinant Antibody

• 

  FC experiment of mouse splenocytes using 98679-1-RR

  1x10^6 mouse splenocytes were surface stained with 0.25 ug Anti-Mouse Fc gamma RIII/CD16+CD32 Rabbit RecAb (98679-1-RR, Clone:252820A1), or Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were then stained with CoraLite® Plus 647 Anti-Mouse CD3e. Cells were not fixed.

• 

  FC experiment of mouse splenocytes using 98679-1-RR

  1x10^6 mouse splenocytes were surface stained with 0.25 ug Anti-Mouse Fc gamma RIII/CD16+CD32 Rabbit RecAb (98679-1-RR, Clone:252820A1) (red) and PE-Conjugated Goat Anti-Rabbit IgG(H+L), or Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue). Cells were not fixed.

CD16/CD32 Uni-rAb^® Recombinant Antibody for FC

Cat No. 98679-1-RR

Clone No.252820A1

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

Synonyms

CD16, CD32, CD16 / CD32, CD16/32, Fc gamma receptor IIB

---

Tested Applications

• Positive FC detected in: mouse splenocytes

Recommended dilution

• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

98679-1-RR targets CD16/CD32 in FC applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3474

  Product name: Recombinant Mouse CD16 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 31-215 aa of NM_001356511

  Sequence: ALPKAVVKLDPPWIQVLKEDMVTLMCEGTHNPGNSSTQWFHNGRSIRSQVQASYTFKATVNDSGEYRCQMEQTRLSDPVDLGVISDWLLLQTPQRVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHHYKSNFSIPKANHSHSGDYYCKGSLGSTQHQSKPVTITVQDPATTSSISLVWYHT

• Full Name: Fc receptor, IgG, low affinity III
• Calculated Molecular Weight: 30 kDa
• GenBank Accession Number: NM_001356511
• Gene Symbol: Fcgr3
• Gene ID (NCBI): 14131
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P08508
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Background Information

CD16 (FcγRIII) is a 50-70 kDa low affinity Fc receptor found on the surface of natural killer cells, neutrophil polymorphonuclear leukocytes, monocytes and macrophages. CD16 mediates antibody-dependent cellular cytotoxicity (ADCC) and other antibody-dependent responses, such as phagocytosis. CD32 (FcγRII) is a 40 kD transmembrane glycoprotein that binds to the Fc region of IgG with low affinity. CD32 is present on phagocytic cells such as macrophages and neutrophils, and is involved in the process of phagocytosis and clearing of immune complexes. Rabbit anti mouse CD16/32 antibody, clone 252820A1 is specific to the common epitope of CD16 and CD32. It can be used for blocking non-specific binding of immunoglobulins to the Fc receptors by preincubating the cells with the purified antibody at 1 ug per million cells in 100 uL volume for 5-10 minutes prior to immunostaining.