FcZero-rAb® CoraLite® Plus 488 Anti-Mouse CD16/CD32 Rabbit Recombinant Antibody

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• FcZero-rAb® CoraLite® Plus 488 Anti-Mouse CD16/CD32 Rabbit Recombinant Antibody (CL488-FcA98679)

• 

  FC experiment of mouse splenocytes using CL488-FcA98679

  1x10^6 mouse splenocytes were surface stained with FcZero-rAb® APC Anti-Mouse CD3 (17A2), and 0.25 ug CoraLite® Plus 488 Anti-Mouse CD16/CD32 Rabbit RecAb (CL488-FcA98679, Clone: 252820A1) or FcZero-rAb® CoraLite® Plus 488 Rabbit IgG Isotype Control Recombinant Antibody (CL488-FcA98136, Clone: 240953C9). Cells were not fixed.

• 

  FC experiment of mouse splenocytes using CL488-FcA98679

  1x10^6 mouse splenocytes were surface stained with 0.25 ug CoraLite® Plus 488 Anti-Mouse CD16/CD32 Rabbit RecAb (CL488-FcA98679, Clone: 252820A1) (red) or FcZero-rAb® CoraLite® Plus 488 Rabbit IgG Isotype Control Recombinant Antibody (CL488-FcA98136, Clone: 240953C9) (blue). Cells were not fixed.

• Zero Fc receptor binding
• Site-specific conjugation
• One universal isotype

CD16/CD32 FcZero-rAb^® Recombinant Antibody for FC

Cat No. CL488-FcA98679

Clone No.252820A1

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

Synonyms

Fc receptor, IgG, low affinity III, Fcgr3

---

Tested Applications

• Positive FC detected in: mouse splenocytes

Recommended dilution

• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-FcA98679 targets CD16/CD32 in FC applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3474

  Product name: Recombinant Mouse CD16 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 31-215 aa of NM_001356511

  Sequence: ALPKAVVKLDPPWIQVLKEDMVTLMCEGTHNPGNSSTQWFHNGRSIRSQVQASYTFKATVNDSGEYRCQMEQTRLSDPVDLGVISDWLLLQTPQRVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHHYKSNFSIPKANHSHSGDYYCKGSLGSTQHQSKPVTITVQDPATTSSISLVWYHT

• Full Name: Fc receptor, IgG, low affinity III
• Calculated Molecular Weight: 30 kDa
• GenBank Accession Number: NM_001356511
• Gene Symbol: Fcgr3
• Gene ID (NCBI): 14131
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Excitation Laser: Blue laser (488 nm)
• Form: Liquid
• Purification Method: Protein A purification
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

CD16 (FcγRIII) is a 50-70 kDa low affinity Fc receptor found on the surface of natural killer cells, neutrophil polymorphonuclear leukocytes, monocytes and macrophages. CD16 mediates antibody-dependent cellular cytotoxicity (ADCC) and other antibody-dependent responses, such as phagocytosis. CD32 (FcγRII) is a 40 kD transmembrane glycoprotein that binds to the Fc region of IgG with low affinity. CD32 is present on phagocytic cells such as macrophages and neutrophils, and is involved in the process of phagocytosis and clearing of immune complexes. Rabbit anti mouse CD16/32 antibody, clone 252820A1 is specific to the common epitope of CD16 and CD32.