Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

CD163 Polyclonal antibody

CD163 Polyclonal Antibody for WB, IHC, IF-P, IP, ELISA

Cat No. 16646-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, pig and More (3)

Applications

WB, IHC, IF-P, IP, ELISA

CD163 molecule, Hemoglobin scavenger receptor, M130, MM130, Scavenger receptor cysteine-rich type 1 protein M130

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman placenta tissue, pig spleen tissue
Positive IP detected inhuman placenta tissue
Positive IHC detected inhuman placenta tissue, human liver tissue, human lung tissue, human tonsillitis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman tonsillitis tissue, human liver tissue, human placenta tissue, human lung cancer tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:1000-1:4000
Immunofluorescence (IF)-PIF-P : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

16646-1-AP targets CD163 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, pig samples.

Tested Reactivity human, pig
Cited Reactivityhuman, mouse, rat, pig, monkey
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag10029

Product name: Recombinant human CD163 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 46-401 aa of BC051281

Sequence: GTDKELRLVDGENKCSGRVEVKVQEEWGTVCNNGWSMEAVSVICNQLGCPTAIKAPGWANSSAGSGRIWMDHVSCRGNESALWDCKHDGWGKHSNCTHQQDAGVTCSDGSNLEMRLTRGGNMCSGRIEIKFQGRWGTVCDDNFNIDHASVICRQLECGSAVSFSGSSNFGEGSGPIWFDDLICNGNESALWNCKHQGWGKHNCDHAEDAGVICSKGADLSLRLVDGVTECSGRLEVRFQGEWGTICDDGWDSYDAAVACKQLGCPTAVTAIGRVNASKGFGHIWLDSVSCQGHEPAVWQCKHHEWGKHYCNHNEDAGVTCSDGSDLELRLRGGGSRCAGTVEVEIQRLLGKVCDRG

Predict reactive species
Full Name CD163 molecule
Calculated Molecular Weight 1156 aa, 125 kDa
Observed Molecular Weight 130-150 kDa
GenBank Accession NumberBC051281
Gene Symbol CD163
Gene ID (NCBI) 9332
ENSEMBL Gene IDENSG00000177575
RRIDAB_2756528
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ86VB7
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD163 is a transmembrane protein which belongs to the scavenger receptor cysteine-rich (SRCR) superfamily. This protein is a scavenger receptor for the hemoglobin-haptoglobin complex and is a marker for monocytes and macrophages. Soluble CD163 (sCD163), as a result of ectodomain shedding during inflammatory activation of macrophages, circulates in blood and has been suggested as a plasma/serum marker for macrophage activity.

Protocols

Product Specific Protocols
IF protocol for CD163 antibody 16646-1-APDownload protocol
IHC protocol for CD163 antibody 16646-1-APDownload protocol
IP protocol for CD163 antibody 16646-1-APDownload protocol
WB protocol for CD163 antibody 16646-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
mouseIF

Mil Med Res

Caveolin-1 is critical for hepatic iron storage capacity in the development of nonalcoholic fatty liver disease

Authors - Guang-Hui Deng
mouse,humanIF

Nat Aging

Single-cell and spatial RNA sequencing identify divergent microenvironments and progression signatures in early- versus late-onset prostate cancer

Authors - Yifei Cheng
humanIF

J Clin Invest

CAP2 promotes gastric cancer metastasis by mediating the interaction between tumor cells and tumor-associated macrophages

Authors - Guohao Zhang
mouseWB

Adv Sci (Weinh)

Inflammatory Fibroblast-Like Synoviocyte-Derived Exosomes Aggravate Osteoarthritis via Enhancing Macrophage Glycolysis

Authors - Bin Liu
humanIHC

Cell Rep Med

Targeting neoadjuvant chemotherapy-induced metabolic reprogramming in pancreatic cancer promotes anti-tumor immunity and chemo-response

Authors - Rong Tang
humanIF

Nat Commun

Single-cell analysis of human glioma and immune cells identifies S100A4 as an immunotherapy target.

Authors - Nourhan Abdelfattah

Reviews

    4.4 out of 5
Add a review

5 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Brittney (Verified Customer) (10-09-2025)

Antibody nicely stained M2 macrophage cells.

  • Applications: Immunohistochemistry, Immunofluorescence
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Tumor

Jaouhara (Verified Customer) (12-05-2023)

Works very well in immunohistochemistry (human cartilage)

  • Applications: Immunohistochemistry
  • Cell Tissue Type: Cartilage

Kenzo (Verified Customer) (08-29-2023)

Works well by IF on frozen mouse liver tissue sections.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: Liver

Yasuyo (Verified Customer) (05-27-2022)

Works pretty good.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:250
  • Cell Tissue Type: Gastric Cancer
CD163 Antibody Immunofluorescence validation (1:250 dilution) in Gastric Cancer (Cat no:16646-1-AP)

Emma (Verified Customer) (11-29-2021)

Works well by IF on FFPE tissue @ 1:100 with a Tris-EDTA antigen retrieval.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: Prostate
CD163 Antibody Immunofluorescence validation (1:100 dilution) in Prostate (Cat no:16646-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...