Tested Applications
| Positive WB detected in | human placenta tissue, pig spleen tissue | 
| Positive IP detected in | human placenta tissue | 
| Positive IHC detected in | human placenta tissue, human liver tissue,  human lung tissue,  human tonsillitis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0  | 
| Positive IF-P detected in | human tonsillitis tissue, human liver tissue, human placenta tissue | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 | 
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate | 
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 | 
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below | 
| WB | See 47 publications below | 
| IHC | See 90 publications below | 
| IF | See 115 publications below | 
Product Information
16646-1-AP targets CD163 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, pig samples.
| Tested Reactivity | human, pig | 
| Cited Reactivity | human, mouse, rat, pig | 
| Host / Isotype | Rabbit / IgG | 
| Class | Polyclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag10029 Product name: Recombinant human CD163 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 46-401 aa of BC051281 Sequence: GTDKELRLVDGENKCSGRVEVKVQEEWGTVCNNGWSMEAVSVICNQLGCPTAIKAPGWANSSAGSGRIWMDHVSCRGNESALWDCKHDGWGKHSNCTHQQDAGVTCSDGSNLEMRLTRGGNMCSGRIEIKFQGRWGTVCDDNFNIDHASVICRQLECGSAVSFSGSSNFGEGSGPIWFDDLICNGNESALWNCKHQGWGKHNCDHAEDAGVICSKGADLSLRLVDGVTECSGRLEVRFQGEWGTICDDGWDSYDAAVACKQLGCPTAVTAIGRVNASKGFGHIWLDSVSCQGHEPAVWQCKHHEWGKHYCNHNEDAGVTCSDGSDLELRLRGGGSRCAGTVEVEIQRLLGKVCDRG Predict reactive species | 
                                    
| Full Name | CD163 molecule | 
| Calculated Molecular Weight | 1156 aa, 125 kDa | 
| Observed Molecular Weight | 130-150 kDa | 
| GenBank Accession Number | BC051281 | 
| Gene Symbol | CD163 | 
| Gene ID (NCBI) | 9332 | 
| ENSEMBL Gene ID | ENSG00000177575 | 
| RRID | AB_2756528 | 
| Conjugate | Unconjugated | 
| Form | Liquid | 
| Purification Method | Antigen affinity purification | 
| UNIPROT ID | Q86VB7 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. | 
Background Information
CD163 is a transmembrane protein which belongs to the scavenger receptor cysteine-rich (SRCR) superfamily. This protein is a scavenger receptor for the hemoglobin-haptoglobin complex and is a marker for monocytes and macrophages. Soluble CD163 (sCD163), as a result of ectodomain shedding during inflammatory activation of macrophages, circulates in blood and has been suggested as a plasma/serum marker for macrophage activity.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CD163 antibody 16646-1-AP | Download protocol | 
| IHC protocol for CD163 antibody 16646-1-AP | Download protocol | 
| IP protocol for CD163 antibody 16646-1-AP | Download protocol | 
| WB protocol for CD163 antibody 16646-1-AP | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 
Publications
| Species | Application | Title | 
|---|---|---|
Mil Med Res Caveolin-1 is critical for hepatic iron storage capacity in the development of nonalcoholic fatty liver disease | ||
Nat Aging Single-cell and spatial RNA sequencing identify divergent microenvironments and progression signatures in early- versus late-onset prostate cancer | ||
J Clin Invest CAP2 promotes gastric cancer metastasis by mediating the interaction between tumor cells and tumor-associated macrophages | ||
Adv Sci (Weinh) Inflammatory Fibroblast-Like Synoviocyte-Derived Exosomes Aggravate Osteoarthritis via Enhancing Macrophage Glycolysis | ||
Cell Rep Med Targeting neoadjuvant chemotherapy-induced metabolic reprogramming in pancreatic cancer promotes anti-tumor immunity and chemo-response | ||
Nat Commun Single-cell analysis of human glioma and immune cells identifies S100A4 as an immunotherapy target. | 
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Brittney (Verified Customer) (10-09-2025)  | Antibody nicely stained M2 macrophage cells. 
  | 
FH Jaouhara (Verified Customer) (12-05-2023)  | Works very well in immunohistochemistry (human cartilage) 
  | 
FH Kenzo (Verified Customer) (08-29-2023)  | Works well by IF on frozen mouse liver tissue sections. 
  | 
FH Yasuyo (Verified Customer) (05-27-2022)  | Works pretty good. 
 ![]()  | 
FH Emma (Verified Customer) (11-29-2021)  | Works well by IF on FFPE tissue @ 1:100 with a Tris-EDTA antigen retrieval. 
 ![]()  | 































