CD164 Polyclonal antibody

• 

  WB analysis using 12083-2-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12083-2-AP (CD164 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human pancreas cancer using 12083-2-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer using 12083-2-AP (CD164 antibody) at dilution of 1:50 (under 10x lens).

CD164 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 12083-2-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

CD164, CD164 molecule, sialomucin, endolyn, MUC 24, Sialomucin core protein 24

---

Tested Applications

• Positive WB detected in: BxPC-3 cells, U-87 MG cells
• Positive IHC detected in: human pancreas cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12083-2-AP targets CD164 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2715

  Product name: Recombinant human CD164 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 24-197 aa of BC011522

  Sequence: DKNTTQHPNVTTLAPISNVTSAPVTSLPLVTTPAPETCEGRNSCVSCFNVSVVNTTCFWIECKDESYCSHNSTVSDCQVGNTTDFCSVSTATPVPTANSTAKPTVQPSPSTTSKTVTTSGTTNNTVTPTSQPVRKSTFDAASFIGGIVLVLGVQAVIFFLYKFCKSKERNYHTL

• Full Name: CD164 molecule, sialomucin
• Calculated Molecular Weight: 197 aa, 21 kDa
• Observed Molecular Weight: 82 kDa
• GenBank Accession Number: BC011522
• Gene Symbol: CD164
• Gene ID (NCBI): 8763
• RRID: AB_2072583
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q04900
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Sialomucins are a heterogeneous group of secreted or membrane-associated mucins that appear to play 2 key but opposing roles in vivo: first as cytoprotective or antiadhesive agents, and second as adhesion receptors. CD164 is a type I integral transmembrane sialomucin that functions as an adhesion receptor (PMID: 9680353)(PMID: 17077324). Sialomucin CD164 (MUC-24), also referred to multi-glycosylated core protein 24 (MGC24), is known to function as a receptor that regulates stem cell localization to the bone marrow. CD164 may play a key role in hematopoiesis by facilitating the adhesion of CD34+ cells to the stroma and by negatively regulating CD34+CD38(lo/-) cell proliferation. Important role of CD164 in in prostate cancer metastasis, promoting myogenesis and regulating myoblast migration so far have been revealed (PMID: 9763543)(PMID: 16859559)(PMID: 17077324).