Product Information
84598-1-PBS targets CD164 in Indirect ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Eg1690 Product name: Recombinant Human CD164 protein (rFc Tag) (HPLC verified) Source: mammalian cells-derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 24-162 aa of NM_006016.6 Sequence: DKNTTQHPNVTTLAPISNVTSAPVTSLPLVTTPAPETCEGRNSCVSCFNVSVVNTTCFWIECKDESYCSHNSTVSDCQVGNTTDFCSVSTATPVPTANSTAKPTVQPSPSTTSKTVTTSGTTNNTVTPTSQPVRKSTFD Predict reactive species |
Full Name | CD164 molecule, sialomucin |
Calculated Molecular Weight | 21kDa |
GenBank Accession Number | NM_006016.6 |
Gene Symbol | CD164 |
Gene ID (NCBI) | 8763 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | Q04900-1 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |