CD1d Monoclonal antibody, PBS Only

• 

  WB analysis of Jurkat using 66257-1-Ig (same clone as 66257-1-PBS)

  WB result of CD1D antibody (66257-1-Ig, 1:500) with si-Control and si-CD1D transfected Jurkat cells. This data was developed using the same antibody clone with 66257-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human testis using 66257-1-Ig (same clone as 66257-1-PBS)

  human testis tissue were subjected to SDS PAGE followed by western blot with 66257-1-Ig (CD1D Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66257-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skin using 66257-1-Ig (same clone as 66257-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skin tissue slide using 66257-1-Ig (CD1d antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 66257-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skin using 66257-1-Ig (same clone as 66257-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skin tissue slide using 66257-1-Ig (CD1d antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 66257-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human small intestine using 66257-1-Ig (same clone as 66257-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 66257-1-Ig (CD1d antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 66257-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human small intestine using 66257-1-Ig (same clone as 66257-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 66257-1-Ig (CD1d antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 66257-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

CD1d Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 66257-1-PBS

Clone No.1C12F1

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

CD1A, CD1D, CD1d molecule, R3, R3G1

---

Product Information

66257-1-PBS targets CD1d in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11108

  Product name: Recombinant human CD1D protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 18-302 aa of BC027926

  Sequence: SAEVPQRLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKPWSQGTFSDQQWETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGCEVHPGNASNNFFHVAFQGKDILSFQGTSWEPTQEAPLWVNLAIQVLNQDKWTRETVQWLLNGTCPQFVSGLLESGKSELKKQVKPKAWLSRGPSPGPGRLLLVCHVSGFYPKPVWVKWMRGEQEQQGTQPGDILPNADETWYLRATLDVVAGEAAGLSCRVKHSSLEGQDIVLYWGGSYTSM

• Full Name: CD1d molecule
• Calculated Molecular Weight: 335 aa, 38 kDa
• Observed Molecular Weight: 40 kDa, 50-55 kDa
• GenBank Accession Number: BC027926
• Gene Symbol: CD1D
• Gene ID (NCBI): 912
• RRID: AB_2881645
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P15813
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CD1d is a member of the CD1 family of transmembrane glycoproteins, which are structurally related to the major histocompatibility complex (MHC) proteins and form heterodimers with beta-2-microglobulin. CD1d is an antigen-presenting protein that binds self and non-self glycolipids and presents them to T-cell receptors on NKT cells. When activated, NKT cells rapidly produce Th1 and Th2 cytokines. The molecular weight of unglycosylated CD1d is 38 kDa, while glycosylated form of CD1d is 48-55 kDa.