Filter: AllWBIHCIF-P

WB analysis using 31909-1-AP (same clone as 31909-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 31909-1-AP (CD20 antibody) at dilution of 1:30000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31909-1-PBS in a different storage buffer formulation.
IHC staining of mouse spleen using 31909-1-AP (same clone as 31909-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 31909-1-AP (CD20 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31909-1-PBS in a different storage buffer formulation.
IHC staining of mouse spleen using 31909-1-AP (same clone as 31909-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 31909-1-AP (CD20 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31909-1-PBS in a different storage buffer formulation.
IHC staining of rat spleen using 31909-1-AP (same clone as 31909-1-PBS)
Immunohistochemical analysis of paraffin-embedded rat spleen tissue slide using 31909-1-AP (CD20 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31909-1-PBS in a different storage buffer formulation.
IHC staining of rat spleen using 31909-1-AP (same clone as 31909-1-PBS)
Immunohistochemical analysis of paraffin-embedded rat spleen tissue slide using 31909-1-AP (CD20 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31909-1-PBS in a different storage buffer formulation.
IF Staining of mouse colon using 31909-1-AP (same clone as 31909-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse colon tissue using CD20 antibody (31909-1-AP) at dilution of 1:400 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31909-1-PBS in a different storage buffer formulation.
IF Staining of mouse colon using 31909-1-AP (same clone as 31909-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse colon tissue using CD20 antibody (31909-1-AP) at dilution of 1:400 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31909-1-PBS in a different storage buffer formulation.
IF Staining of mouse spleen using 31909-1-AP (same clone as 31909-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse spleen tissue using CD20 antibody (31909-1-AP) at dilution of 1:400 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31909-1-PBS in a different storage buffer formulation.
IF Staining of mouse spleen using 31909-1-AP (same clone as 31909-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse spleen tissue using CD20 antibody (31909-1-AP) at dilution of 1:400 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31909-1-PBS in a different storage buffer formulation.
IF Staining of rat spleen using 31909-1-AP (same clone as 31909-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded rat spleen tissue using CD20 antibody (31909-1-AP) at dilution of 1:400 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31909-1-PBS in a different storage buffer formulation.
IF Staining of rat spleen using 31909-1-AP (same clone as 31909-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded rat spleen tissue using CD20 antibody (31909-1-AP) at dilution of 1:400 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31909-1-PBS in a different storage buffer formulation.

Mouse CD20 Polyclonal antibody, PBS Only

Name: Mouse CD20 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 31909-1-PBS

CD20 Polyclonal Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 31909-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

B-cell differentiation antigen Ly-44, B-lymphocyte antigen CD20, Lymphocyte antigen 44, Membrane-spanning 4-domains subfamily A member 1

Formulation: PBS Only

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

31909-1-PBS targets CD20 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with mouse, rat samples.

Tested Reactivity	mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag36918 Product name: Recombinant mouse Ms4a1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 204-291 aa of NM_007641 Sequence: GIVENEWKRMCTRSKSNVVLLSAGEKNEQTIKMKEEIIELSGVSSQPKNEEEIEIIPVQEEEEEEAEINFPAPPQEQESLPVENEIAP* Predict reactive species
Full Name	membrane-spanning 4-domains, subfamily A, member 1
Calculated Molecular Weight	32 kDa
Observed Molecular Weight	35 kDa
GenBank Accession Number	NM_007641
Gene Symbol	Ms4a1
Gene ID (NCBI)	12482
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity Purification
UNIPROT ID	P19437
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

CD20 is a 33-37 kDa transmembrane phosphoprotein. CD20 is a B-lymphocyte surface molecule that is widely expressed during B-cell ontogeny, from early pre-B-cell developmental stages until final differentiation into plasma cells. CD20 functions as a calcium-permeable cation channel. It is involved in the regulation of B-cell activation and proliferation. CD20 serves as a useful target for antibody-mediated therapeutic depletion of B-cells.