CD200R1L Polyclonal antibody

• 

  WB analysis using 34012-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 34012-1-AP (CD200R1L antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse spleen using 34012-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 34012-1-AP (CD200R1L antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse spleen using 34012-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 34012-1-AP (CD200R1L antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

CD200R1L Polyclonal Antibody for WB, IHC, ELISA

Cat No. 34012-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, IHC, ELISA

Synonyms

CD200 cell surface glycoprotein receptor-like 2, CD200 cell surface glycoprotein receptor-like c, CD200 receptor-like 2, Cd200r2, CD200RLc

---

Tested Applications

• Positive WB detected in: mouse spleen tissue, rat spleen tissue
• Positive IHC detected in: mouse spleen tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

34012-1-AP targets CD200R1L in WB, IHC, ELISA applications and shows reactivity with mouse, rat samples.

• Tested Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Eg6118

  Product name: Recombinant mouse Cd200r1l protein

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 25-220 aa of NM_206535.1

  Sequence: IVSVQMGTKARLCCRSIPLTKAVLITWIIKPRGQPSCIMAYKVETKETNETCLGRNITWASTPDHIPDLQISAVALQHEGNYLCEITTPEGNFHKVYDLQVLVPPEVTYFLGENRTAVCEAMAGKPAAQISWTPDGDCVTKSESHSNGTVTVRSTCHWEQNNVSAVSCIVSHSTGNQSLSIELSRGTTSTTPSLLT

• Full Name: Cd200 receptor 2
• Calculated Molecular Weight: 27 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: NM_206535.1
• Gene Symbol: Cd200r2
• Gene ID (NCBI): 271375
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q6XJV6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The CD200 Receptor (CD200R) gene family in humans encodes one inhibitory receptor, CD200R1, and one putative activating member, CD200R1 Like (CD200R1L). It is demonstrated that CD200R1L is endogenously expressed by human neutrophils and activates cellular functions such as reactive oxygen species (ROS) production via Syk, PI3Kβ, PI3Kδ, and Rac GTPase signaling. Phylogenetic analysis shows that CD200R1L is present in many species among vertebrates, ranging from birds to primates, suggesting that evolutionary conservation of this receptor is critical for protection against co-evolving pathogens. The duplication event that generated CD200R1L from CD200R occurred several times throughout evolution, supporting convergent evolution of CD200R1L. In our phylogenetic trees, CD200R1L has longer branch lengths than CD200R1 in most species, suggesting that CD200R1L is evolving faster than CD200R1. It is proposed that CD200R1L represents a hitherto uncharacterized activating receptor on human neutrophils (PMID: 33884657).