Tested Applications
| Positive WB detected in | Jurkat cells, human spleen tissue, mouse spleen tissue |
| Positive IP detected in | Jurkat cells |
| Positive IHC detected in | human tonsillitis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | Jurkat cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 7 publications below |
| IHC | See 1 publications below |
| IF | See 1 publications below |
| IP | See 1 publications below |
| FC | See 1 publications below |
Product Information
12837-2-AP targets CD247 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3889 Product name: Recombinant human CD247 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 50-164 aa of BC025703 Sequence: FLRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR Predict reactive species |
| Full Name | CD247 molecule |
| Calculated Molecular Weight | 16 kDa |
| Observed Molecular Weight | 16 kDa |
| GenBank Accession Number | BC025703 |
| Gene Symbol | CD247 |
| Gene ID (NCBI) | 919 |
| RRID | AB_2244279 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P20963 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CD247, also known as CD3Z (T-cell surface glycoprotein CD3 zeta chain), belongs to the CD3Z/FCER1G family. CD3 is a complex of proteins that directly associates with the T cell receptor (TCR). The TCR/CD3 complex of T-lymphocytes consists of either a TCR alpha/beta or TCR gamma/delta heterodimer coexpressed at the cell surface with the invariant subunits of CD3 labeled gamma, delta, epsilon, zeta, and eta. The TCR recognizes antigens bound to major histocompatibility complex (MHC) molecules. TCR-mediated peptide-MHC recognition is transmitted to the CD3 complex, leading to the intracellular signal transduction. CD3 is considered to be a pan-T cell marker for detection of normal and neoplastic T cells.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CD247 antibody 12837-2-AP | Download protocol |
| IHC protocol for CD247 antibody 12837-2-AP | Download protocol |
| IP protocol for CD247 antibody 12837-2-AP | Download protocol |
| WB protocol for CD247 antibody 12837-2-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Front Immunol Efficacy and safety evaluation of cross-reactive Fibroblast activation protein scFv-based CAR-T cells | ||
Front Immunol The Transferrin Receptor-Directed CAR for the Therapy of Hematologic Malignancies. | ||
PLoS One Liver Sinusoidal Endothelial Cell-Mediated CD8 T Cell Priming Depends on Co-Inhibitory Signal Integration over Time. | ||
Cytotherapy Bruton tyrosine kinase inhibitors preserve anti-CD19 chimeric antigen receptor T-cell functionality and reprogram tumor micro-environment in B-cell lymphoma | ||
Nat Commun Cell volume controlled by LRRC8A-formed volume-regulated anion channels fine-tunes T cell activation and function | ||
Int Immunopharmacol Three-gene signature revealing the dynamics of lymphocyte infiltration in subchondral bone during osteoarthritis progression |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Haizhen (Verified Customer) (10-15-2019) | specific for human CD3 zeta protein
|















