TEM1/CD248 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• TEM1/CD248 Polyclonal antibody (18160-1-AP)

• Featured Product
• KD/KO Validated

TEM1/CD248 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 18160-1-AP Copied!

Publications (16)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, CoIP, ELISA

Synonyms

CD248, TEM1, CD164L1, CD248 molecule, endosialin, Endosialin

• 

  WB analysis of HUVEC using 18160-1-AP

  HUVEC cells were subjected to SDS PAGE followed by western blot with 18160-1-AP (TEM1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 18160-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 18160-1-AP (TEM1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary cancer using 18160-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 18160-1-AP (TEM1 antibody) at dilution of 1:8000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary cancer using 18160-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 18160-1-AP (TEM1 antibody) at dilution of 1:8000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 18160-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 18160-1-AP (TEM1 antibody) at dilution of 1:4000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 18160-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 18160-1-AP (TEM1 antibody) at dilution of 1:4000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 18160-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer using 18160-1-AP (TEM1 antibody) at dilution of 1:500 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 18160-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer using 18160-1-AP (TEM1 antibody) at dilution of 1:500 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for TEM1/CD248 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HUVEC cells
• Positive IHC detected in: human ovary cancer tissue, human colon cancer tissue, human lung cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:4000-1:16000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

18160-1-AP targets TEM1/CD248 in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12990

  Product name: Recombinant human CD248 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 21-401 aa of BC051340

  Sequence: WAAEPRAACGPSSCYALFPRRRTFLEAWRACRELGGDLATPRTPEEAQRVDSLVGAGPASRLLWIGLQRQARQCQLQRPLRGFTWTTGDQDTAFTNWAQPASGGPCPAQRCVALEASGEHRWLEGSCTLAVDGYLCQFGFEGACPALQDEAGQAGPAVYTTPFHLVSTEFEWLPFGSVAAVQCQAGRGASLLCVKQPEGGVGWSRAGPLCLGTGCSPDNGGCEHECVEEVDGHVSCRCTEGFRLAADGRSCEDPCAQAPCEQQCEPGGPQGYSCHCRLGFRPAEDDPHRCVDTDECQIAGVCQQMCVNYVGGFECYCSEGHELEADGISCSPAGAMGAQASQDLGDELLDDGEDEEDEDEAWKAFNGGWTEMPGILWMEPT

• Full Name: CD248 molecule, endosialin
• Calculated Molecular Weight: 757 aa, 81 kDa
• Observed Molecular Weight: 160 kDa
• GenBank Accession Number: BC051340
• Gene Symbol: TEM1
• Gene ID (NCBI): 57124
• RRID: AB_2073200
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9HCU0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TEM1 (Tumor endothelial marker 1), also named as CD248, Endosialin and CD164L1, is a C-type lectin-like domain (CTLD) containing type I transmembrane glycoprotein. It is now considered to be a highly selective marker for activated perivascular and stromal cells, detected in most cancers and at least some inflammatory disorders. CD248 plays a role in tumor angiogenesis. It is a potential diagnostic tool and therapeutic target of inflammatory and malignant disease. Two isoforms of human TEM1 exist. The calculated molecular weights of the two isoforms are 81 kDa and 46 kDa, respectively. Native TEM1 can be glycosylated, and the glycosylated form has a larger apparent molecular weight than 81 kDa.

Publications

What published studies show

The anti-CD248/Endosialin antibody (Cat# 18160-1-AP) has 16 total citations published in journals including Cancer Cell, Cancer Research, Journal of Biomedical Science, EBioMedicine, Molecular Medicine, Journal of Investigative Dermatology, Oncotarget, Scientific Reports, BMC Cancer, and PLoS One. Research fields span oncology (lung, liver, melanoma, sarcoma), fibrosis (hepatic, cardiac, pulmonary), wound healing, metabolic disease, pulmonary arterial hypertension, and stromal cell biology.

Automatically generated from the 16 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Cancer Cell; Cancer-associated fibroblast phenotypes are associated with patient outcome in non-small cell lung cancer; Authors - Lena Cords
human	IF	Cancer Res; Interaction with CD68 and regulation of GAS6 expression by endosialin in fibroblasts drives recruitment and polarization of macrophages in hepatocellular carcinoma.; Authors - Fa Yang
mouse,human	WB,IF	J Biomed Sci; TEM1/endosialin/CD248 promotes pathologic scarring and TGF-β activity through its receptor stability in dermal fibroblasts; Authors - Yi-Kai Hong ; KD Validated
mouse,human	WB,IHC	J Biomed Sci; Interference in melanoma CD248 function reduces vascular mimicry and metastasis; Authors - Cheng-Hsiang Kuo ; KD Validated
human	WB,IHC,IF	Int J Biol Sci; Regulation of matrix reloading by tumor endothelial marker 1 protects against abdominal aortic aneurysm; Authors - Yi-Kai Hong ; KD Validated
mouse	IF	EBioMedicine; Specific loss of adipocyte CD248 improves metabolic health via reduced white adipose tissue hypoxia, fibrosis and inflammation.; Authors - Paul Petrus