CD268/BAFF-R Monoclonal antibody

• Home
• Products
• Primary Antibodies
• CD268/BAFF-R Monoclonal antibody (60763-7-Ig)

• 

  IHC staining of human spleen using 60763-7-Ig

  Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 60763-7-Ig (CD268/BAFF-R antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human spleen using 60763-7-Ig

  Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 60763-7-Ig (CD268/BAFF-R antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 60763-7-Ig

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 60763-7-Ig (CD268/BAFF-R antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 60763-7-Ig

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 60763-7-Ig (CD268/BAFF-R antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

CD268/BAFF-R Monoclonal Antibody for IHC, ELISA

Cat No. 60763-7-Ig

Clone No.2B12D1

Host / Isotype

Mouse / IgG2a

Reactivity

human

Applications

IHC, ELISA

Synonyms

TNFRSF13C, BAFF R, BAFF receptor, BAFFR, BAFF-R

---

Tested Applications

• Positive IHC detected in: human tonsillitis tissue, human spleen tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

60763-7-Ig targets CD268/BAFF-R in IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18512

  Product name: Recombinant human TNFRSF13C protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-184 aa of BC105123

  Sequence: MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAALPLPGLLFGAPALLGLALVLALVLVGLVSWRRRQRRLRGASSAEAPDGDKDAPEPLDKVIILSPGISDATAPAWPPPGEDPGTTPPGHSVPVPATELGSTELVTTKTAGPEQQ

• Full Name: tumor necrosis factor receptor superfamily, member 13C
• Calculated Molecular Weight: 184 aa, 19 kDa
• GenBank Accession Number: BC105123
• Gene Symbol: TNFRSF13C
• Gene ID (NCBI): 115650
• RRID: AB_3743233
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q96RJ3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

B-cell-activating factor receptor (BAFF-R, also known as CD268 and TNFRSF13C) is a member of the tumor necrosis factor receptor (TNFR) superfamily. It is expressed in most malignant B cells, including those in primary central nervous system lymphoma (PCNSL), and is involved in the survival and proliferation of these cells (PMID: 32528875). The interaction of BAFF with BAFF-R promotes NF-κB activation, which plays a crucial role in B-cell maturation, survival, and costimulation of T-cell activation and proliferation (PMID: 30349534). Additionally, BAFF-R is associated with chronic kidney disease (CKD) by activating NF-κB signaling in renal tubular epithelial cells (PMID: 38791453).