CD27/TNFRSF7 Recombinant monoclonal antibody

• 

  WB analysis using 87691-3-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87691-3-RR (CD27/TNFRSF7 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

CD27/TNFRSF7 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 87691-3-RR

Clone No.253071D4

Host / Isotype

Rabbit / IgG

Reactivity

rat

Applications

WB, ELISA

Synonyms

Cd27, CD27 antigen, CD27L receptor, MGC112688, rCG_30251

---

Tested Applications

• Positive WB detected in: rat spleen tissue, rat kidney tissue, rat liver tissue

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87691-3-RR targets CD27/TNFRSF7 in WB, ELISA applications and shows reactivity with rat samples.

• Tested Reactivity: rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg5288

  Product name: Recombinant rat CD27/TNFRSF7 protein

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 21-181 aa of NM_001024335.1

  Sequence: TPAPNNCPDRHYWIGAGLCCQMCGPGTFLVKHCDQDRAAAQCDPCIPGTSFSPDYHTRPHCESCRHCNSGFLIRNCTVTANAECTCSKGWQCRDQECTECDPPLNPALTSQPSEAPSPQLPPPTHLPYATEKPSWPPQRQLPDSTVYSRLPSQRPLCSSDC

• Full Name: CD27 molecule
• Calculated Molecular Weight: 28 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: NM_001024335.1
• Gene Symbol: Cd27
• Gene ID (NCBI): 500318
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q501W2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Rat CD27 (TNFRSF7) is a member of the tumor necrosis factor receptor superfamily (TNFRSF). It is a type I transmembrane glycoprotein primarily expressed on the surface of T lymphocytes, B cells, and natural killer (NK) cells. As an important T cell co-stimulatory molecule, CD27 binds to its ligand, CD70. This interaction recruits TRAF2/5, activating the NF-κB and JNK signaling pathways, which promotes T cell proliferation, differentiation, and survival while inhibiting apoptosis. The expression level of CD27 serves as a crucial marker for T cell activation and memory status, and soluble CD27 (sCD27) can act as a clinical marker of immune activation. In cancer immunotherapy, CD27 is a significant target. Agonistic antibodies, such as Varlilumab, can enhance anti-tumor T cell responses and have entered clinical trials.