PD-L1/CD274 Fusion Protein

Catalog number: Ag12443
  • Print page
  • Download PDF

Be the first to review this product


$199.00€199.00£199.00

Freight/Packing £00.00

Size: 09µ/gram

Format: Liquid

Please visit your regions distributor:


You can also
Request A Quote

Images See all

PD-L1/CD274 fusion protein Ag12443 SDS-PAGE


Product Name:
human CD274-6*His fusion protein

Catalog No:
Ag12443

Source:
E. coli-derived, PET28a

Peptide Sequence:
KDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERTHL
(25 - 241 aa encoded by BC074984)

Activity:
Not tested.

Endotoxin Level:
Please contact the lab for more information.

Back
to top