• Zero Fc receptor binding
  • Site-specific conjugation
  • One universal isotype

FcZero-rAb® PE Anti-Human CD28 Rabbit Recombinant Antibody

CD28 FcZero-rAb® Recombinant Antibody for FC
Cat No. PE-FcA98032
Clone No.240354D2

Host / Isotype

Rabbit / IgG

Reactivity

human, monkey, non-human primates

Applications

FC

CD28 molecule, T-cell-specific surface glycoprotein CD28, Tp44

Formulation:  PBS, Azide, BSA
PBS, Azide, BSA
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC detected inhuman PBMCs, cynomolgus PBMCs

Recommended dilution

ApplicationDilution
Flow Cytometry (FC)FC : 5 ul per 10^6 cells in a 100 µl suspension
This reagent has been pre-titrated and tested for flow cytometric analysis. The suggested use of this reagent is 5 ul per 10^6 cells in a 100 µl suspension or 5 ul per 100 µl of whole blood.
Sample-dependent, Check data in validation data gallery.

Product Information

PE-FcA98032 targets CD28 in FC applications and shows reactivity with human, monkey, non-human primates samples.

Tested Reactivity human, monkey, non-human primates
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg0889

Product name: Recombinant Human CD28 protein (His Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-6*HIS

Domain: 19-152 aa of BC093698

Sequence: NKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKP

Predict reactive species
Full Name CD28 molecule
Calculated Molecular Weight 220 aa, 25 kDa
GenBank Accession NumberBC093698
Gene Symbol CD28
Gene ID (NCBI) 940
ENSEMBL Gene IDENSG00000178562
Conjugate PE Fluorescent Dye
Excitation/Emission Maxima Wavelengths496 nm, 565 nm / 578 nm
Excitation LaserBlue Laser (488 nm), Green Laser (532 nm), Yellow-Green Laser (561 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP10747
Storage Buffer PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

CD28 (T-cell-specific surface glycoprotein CD28), also known as T44 and Tp44, is a 44 kD disulfide-linked homodimeric type I glycoprotein (PMID: 2162180). It is a member of the immunoglobulin superfamily and is expressed on most T lineage cells, NK cell subsets, and plasma cells (PMID: 2162180, 8386518). CD28 may affect in vivo immune responses by functioning both as a cell adhesion molecule linking B and T lymphocytes and as the surface component of a novel signal transduction pathway (PMID: 2162180, 3021470). CD28 binds both CD80 and CD86 with a highly conserved motif MYPPY in the CDR3-like loop (PMID: 15696168, 7964482). CD28 is considered a major co-stimulatory molecule, inducing T lymphocyte activation and IL-2 synthesis, and preventing cell death (PMID: 1348520).

Protocols

Product Specific Protocols
FC protocol for PE CD28 antibody PE-FcA98032Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...