Mouse CD297/ART4 Recombinant monoclonal antibody, PBS Only (Detector)

• 

  WB analysis using 87399-1-RR (same clone as 87399-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87399-1-RR (CD297/ART4 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87399-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 87399-1-RR (same clone as 87399-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87399-1-RR (CD297/ART4 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87399-1-PBS in a different storage buffer formulation.

• 

  Cytometric bead array sample test of MP03043-1

  The mean ART4/CD297 concentration was determined to be 83.5 ng/mL in Mouse liver tissue extract based on a 8.4 mg/mL extract load, 107.1 ng/mL in Mouse spleen tissue extract based on a 6.4 mg/mL extract load, Mouse brain tissue extract were served as a negative control.

• 

  Cytometric bead array standard curve of MP03043-1

  Cytometric bead array standard curve of MP03043-1, MOUSE ART4/CD297 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 87399-2-PBS. Detection antibody: 87399-1-PBS. Standard: Eg6315. Range: 0.156-20 ng/mL.

CD297/ART4 Uni-rAb^® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA

Cat No. 87399-1-PBS

Clone No.252721F4

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, Cytometric bead array, Indirect ELISA

Synonyms

ADP-ribosyltransferase C2 and C3 toxin-like 4, Art4, ARTC4, CD297, EC:2.4.2.31

---

Product Information

87399-1-PBS targets CD297/ART4 as part of a matched antibody pair:

MP03043-1: 87399-2-PBS capture and 87399-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg6315

  Product name: Recombinant mouse CD297/ART4 protein

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 24-263 aa of NM_026639.2

  Sequence: GSTEAPLKVDVDLTPDSFDDQYQGCSEQMVEELNQGDYFIKEVDTHKYYSRAWQKAHLTWLNQAKALPESMTPVHAVAIVVFTLNLNVSSDLAKAMARAAGSPGQYSQSFHFKYLHYYLTSAIQLLRKDSSTKNGSLCYKVYHGMKDVSIGANVGSTIRFGQFLSASLLKEETRVSGNQTLFTIFTCLGASVQDFSLRKEVLIPPYELFEVVSKSGSPKGDLINLRSAGNMSTYNCQLLK

• Full Name: ADP-ribosyltransferase 4
• Calculated Molecular Weight: 33 kDa
• Observed Molecular Weight: 33 kDa
• GenBank Accession Number: NM_026639.2
• Gene Symbol: Art4
• Gene ID (NCBI): 109978
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9CRA0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CD297/ART4 is a GPI-anchored ecto-ADP-ribosyltransferase best known as the molecular carrier of Dombrock blood group antigens on erythrocytes. Expressed on red blood cells, hematopoietic progenitors, and select immune cells, it participates in cell-surface signaling and immune recognition, though its catalytic activity is limited. CD297/ART4 polymorphisms underlie clinically significant transfusion reactions, making it a key target in hematology, transfusion medicine, and erythroid biology.