CD300a Monoclonal antibody

• 

  WB analysis of THP-1 using 67242-1-Ig

  THP-1 cells were subjected to SDS PAGE followed by western blot with 67242-1-Ig (CD300A antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of K-562 using 67242-1-Ig

  K-562 cells were subjected to SDS PAGE followed by western blot with 67242-1-Ig (CD300A antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HL-60 using 67242-1-Ig

  HL-60 cells were subjected to SDS PAGE followed by western blot with 67242-1-Ig (CD300A antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human spleen using 67242-1-Ig

  human spleen tissue were subjected to SDS PAGE followed by western blot with 67242-1-Ig (CD300A antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Raji using 67242-1-Ig

  Raji cells were subjected to SDS PAGE followed by western blot with 67242-1-Ig (CD300A antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 67242-1-Ig

  Jurkat cells were subjected to SDS PAGE followed by western blot with 67242-1-Ig (CD300A antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

CD300a Monoclonal Antibody for WB, ELISA

Cat No. 67242-1-Ig

Clone No.2F9C5

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, ELISA

Synonyms

CMRF 35 H9, CLM-8, CLM 8, CD300a molecule, CD300 antigen-like family member A

---

Tested Applications

• Positive WB detected in: THP-1 cells, HL-60 cells, human spleen tissue, Jurkat cells, K-562 cells, Raji cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67242-1-Ig targets CD300a in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5776

  Product name: Recombinant human CD300A protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 21-141 aa of BC032352

  Sequence: CRTVAGPVGGSLSVQCPYEKEHRTLNKYWCRPPQIFLCDKIVETKGSAGKRNGRVSIRDSPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDFHDPVVEVEVSVFPASTSMTPASITAAKT

• Full Name: CD300a molecule
• Calculated Molecular Weight: 299 aa, 33 kDa
• Observed Molecular Weight: 50-60 kDa
• GenBank Accession Number: BC032352
• Gene Symbol: CD300a
• Gene ID (NCBI): 11314
• RRID: AB_2882521
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9UGN4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.