CD300a Monoclonal antibody, PBS Only (Detector)

• 

  WB analysis of THP-1 using 67242-1-Ig (same clone as 67242-1-PBS)

  THP-1 cells were subjected to SDS PAGE followed by western blot with 67242-1-Ig (CD300A antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67242-1-PBS in a different storage buffer formulation.

• 

  WB analysis of K-562 using 67242-1-Ig (same clone as 67242-1-PBS)

  K-562 cells were subjected to SDS PAGE followed by western blot with 67242-1-Ig (CD300A antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67242-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HL-60 using 67242-1-Ig (same clone as 67242-1-PBS)

  HL-60 cells were subjected to SDS PAGE followed by western blot with 67242-1-Ig (CD300A antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67242-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human spleen using 67242-1-Ig (same clone as 67242-1-PBS)

  human spleen tissue were subjected to SDS PAGE followed by western blot with 67242-1-Ig (CD300A antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67242-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Raji using 67242-1-Ig (same clone as 67242-1-PBS)

  Raji cells were subjected to SDS PAGE followed by western blot with 67242-1-Ig (CD300A antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67242-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 67242-1-Ig (same clone as 67242-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 67242-1-Ig (CD300A antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67242-1-PBS in a different storage buffer formulation.

• 

  Cytometric bead array standard curve of MP50466-1

  Cytometric bead array standard curve of MP50466-1, CD300A Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 67242-2-PBS. Detection antibody: 67242-1-PBS. Standard:Ag5776. Range: 0.391-100 ng/mL.

CD300a Monoclonal Antibody for WB, Cytometric bead array, Indirect ELISA

Cat No. 67242-1-PBS

Clone No.2F9C5

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, Cytometric bead array, Indirect ELISA

Synonyms

2F9C5, CD300 antigen-like family member A, CD300a molecule, CLM 8, CLM-8

---

Product Information

67242-1-PBS targets CD300a as part of a matched antibody pair:

MP50466-1: 67242-2-PBS capture and 67242-1-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5776

  Product name: Recombinant human CD300A protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 21-141 aa of BC032352

  Sequence: CRTVAGPVGGSLSVQCPYEKEHRTLNKYWCRPPQIFLCDKIVETKGSAGKRNGRVSIRDSPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDFHDPVVEVEVSVFPASTSMTPASITAAKT

• Full Name: CD300a molecule
• Calculated Molecular Weight: 299 aa, 33 kDa
• Observed Molecular Weight: 50-60 kDa
• GenBank Accession Number: BC032352
• Gene Symbol: CD300a
• Gene ID (NCBI): 11314
• RRID: AB_2882521
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9UGN4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.