CD300a Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• CD300a Recombinant monoclonal antibody (87050-1-RR)

• 

  WB analysis using 87050-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87050-1-RR (CD300a antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  Affinity and Kinetic Characterization of 87050-1-RR

  Biolayer interferometry (BLl) kinetic assays of 87050-1-RR against Mouse CD300a were performed. The affinity constant is 3.76 nM.

CD300a Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 87050-1-RR

Clone No.251972C10

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, ELISA

Synonyms

CLM-8, CMRF35-like molecule 8

---

Tested Applications

• Positive WB detected in: J774A.1 cells, RAW 264.7 cells, mouse spleen tissue, rat spleen tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87050-1-RR targets CD300a in WB, ELISA applications and shows reactivity with mouse, rat samples.

• Tested Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2675

  Product name: recombinant mouse Cd300a protein

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 28-183 aa of

  Sequence: LHGPSTMSGSVGESLSVSCRYEEKFKTKDKYWCRVSLKILCKDIVKTSSSEEARSGRVTIRDHPDNLTFTVTYESLTLEDADTYMCAVDISLFDGSLGFDKYFKIELSVVPSEDPVSSPGPTLETPVVSTSLPTKGPALGSNTEGHREHDYSQGLR

• Full Name: CD300A antigen
• Calculated Molecular Weight: 36 kDa
• Observed Molecular Weight: 60-70 kDa
• Gene Symbol: Cd300a
• Gene ID (NCBI): 217303
• RRID: AB_3745301
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q6SJQ0-1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD300a is a transmembrane protein with an immunoglobulin (Ig)V-like extracellular domain and a cytoplasmic tail containing immunoreceptor tyrosine-based inhibitory motifs (ITIMs), providing the receptor with an inhibitory capacity. The relevance of the CD300a molecule in several pathological conditions has been highlighted by multiple studies. (PMID: 37762055)