CD31 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CD31 Polyclonal antibody (33075-1-AP)

• 

  WB analysis using 33075-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33075-1-AP (CD31 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of rat lung using 33075-1-AP

  Immunohistochemical analysis of paraffin-embedded rat lung tissue slide using 33075-1-AP (CD31 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat lung using 33075-1-AP

  Immunohistochemical analysis of paraffin-embedded rat lung tissue slide using 33075-1-AP (CD31 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat kidney using 33075-1-AP

  Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 33075-1-AP (CD31 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat kidney using 33075-1-AP

  Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 33075-1-AP (CD31 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

CD31 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 33075-1-AP

Publications(17)

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, IHC, IF, ELISA

Synonyms

Pecam, Pecam1, PECAM-1, Platelet endothelial cell adhesion molecule

---

Tested Applications

• Positive WB detected in: bEnd.3 cells, rat lung tissue
• Positive IHC detected in: rat lung tissue, rat kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

This antibody does not react with human CD31.

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• IHC: See 12 publications below
• IF: See 8 publications below

Product Information

33075-1-AP targets CD31 in WB, IHC, IF, ELISA applications and shows reactivity with mouse, rat samples.

• Tested Reactivity: mouse, rat
• Cited Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Eg1456

  Product name: recombinant rat CD31/PECAM-1 protein

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 18-589 aa of NP_113779.1

  Sequence: QENSFTINSIHMESRPSWEVSNGQKLTLQCLVDISTTSKSRPQHQVLFYKDDALVYNVSSSEHTESFVIPQSRVFHAGKYKCTVILNSKEKTTIEYQLTVNGVPMPEVTVDKKEVTEGGIVTVNCSMQEEKPPIYFKIEKVELGTKNVKLSREKTSNMNFVLIEFPIEEQDHLLVFRCQAGVLSGIKMQTSEFIRSEYVTVQEFFSTPKFQIQPPEMIIEGNQLHIKCSVQVAHLAQEFPEIIIQKDKAIVATSKQSKEAVYSVMALVEHSGHYTCKVESNRISKASSILVNITELFPRPKLELSSSRLDQGEMLDLSCSVSGAPVANFTIQKEETVLSQYQNFSKIAEERDSGLYSCTAGIGKVVKRSNLVPVQVCEMLSKPRIFHDAKFEIIKGQIIGISCQSVNGTAPITYRLLRAKSNFQTVQKNSNDPVTFTDKPTRDMEYQCIVDNCHSHPEVRSEILRVKVIAPVDEVTISILSGNDVQSGDEMVLRCSVKEGTGPVTFQFYKEKEGRPFHEETVNDTQVFWHHEQTSKEQEGQYYCTAFNRASIVTSLRSGPLTVRVFLAPWKK

• Full Name: platelet/endothelial cell adhesion molecule 1
• Calculated Molecular Weight: 76kDa
• Observed Molecular Weight: 100-120 kDa
• GenBank Accession Number: NP_113779.1
• Gene Symbol: Pecam1
• Gene ID (NCBI): 29583
• RRID: AB_3742844
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q3SWT0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Platelet endothelial cell adhesion molecule-1 (PECAM-1, CD31) is a member of the immunoglobulin gene superfamily of cell adhesion molecules. CD31 is a transmembrane glycoprotein that is highly expressed on the surface of the endothelium, making up a large portion of its intracellular junctions. PECAM-1 is also present on the surface of hematopoietic cells and immune cells including platelets, monocytes, neutrophils, natural killer cells, megakaryocytes and some types of T-cell (PMID: 9011572). As well as its role in cell-cell adhesion, PECAM-1 functions as a signaling receptor, and is involved in important physiological events such as nitric oxide production, regulation of T-cell immunity and tolerance, leukocyte transendothelial migration and inflammation and angiogenesis (PMID: 21183735; 20978210; 17872453; 20634489).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	IF, IHC	J Biol Eng; Curcumin-loaded silk fibroin scaffold promotes cartilage regeneration by inhibiting angiogenesis via Drp1/ROS-mediated mitochondrial regulation.; Authors - Zitong Zhao
rat	IF	J Nanobiotechnology; Piezo-herbal microneedle patches enable wireless endometrial regeneration and fertility recovery.; Authors - Rui Zhao
mouse	WB	J Transl Med; Integration of angiogenesis and programmed cell death mechanisms unveils potential diagnostic and therapeutic targets in spinal cord injury.; Authors - Feng Lu
rat	IHC,IF	Bioact Mater; Bioprinting of live platelet-loaded nerve conduit using energy-dissipative hydrogel.; Authors - Jiamei Zhang
rat	IHC	J Nanobiotechnology; Protocatechualdehyde-functionalized BMSC-derived exosomes orchestrate calcium signaling in the immunoinflammatory microenvironment to promote periodontal regeneration.; Authors - Le Fan
rat	IHC	Adv Sci (Weinh); Precise Construction of an Antimicrobial Peptide Targeting Bacterial Cell Membranes Derived From Natural Peptides.; Authors - Jiaqi Huang