Mouse CD37 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 85917-1-RR (same clone as 85917-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85917-1-RR (Cd37 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85917-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse spleen using 85917-1-RR (same clone as 85917-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 85917-1-RR (CD37 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85917-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse spleen using 85917-1-RR (same clone as 85917-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 85917-1-RR (CD37 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85917-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse spleen using 85917-1-RR (same clone as 85917-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse spleen tissue using CD37 antibody (85917-1-RR, Clone: 250262A3 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85917-1-PBS in a different storage buffer formulation.

• 

  IF Staining of rat spleen using 85917-1-RR (same clone as 85917-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded rat spleen tissue using CD37 antibody (85917-1-RR, Clone: 250262A3 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85917-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A20 using 85917-1-RR (same clone as 85917-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A20 cells using Cd37 antibody (85917-1-RR, Clone: 250262A3 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 85917-1-PBS in a different storage buffer formulation.

CD37 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, IF-P, Indirect ELISA

Cat No. 85917-1-PBS

Clone No.250262A3

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, IHC, IF/ICC, IF-P, Indirect ELISA

Synonyms

Leukocyte antigen CD37, Tetraspanin 26, TSPAN26

---

Product Information

85917-1-PBS targets CD37 in WB, IHC, IF/ICC, IF-P, Indirect ELISA applications and shows reactivity with mouse, rat samples.

• Tested Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2729

  Product name: Recombinant Mouse CD37 protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 112-241 aa of NM_007645.4

  Sequence: RVRLERRVQELVLRTIQSYRTNPDETAAEESWDYAQFQLRCCGWQSPRDWNKAQMLKANESEEPFVPCSCYNSTATNDSTVFDKLFFSQLSRLGPRAKLRQTADICALPAKAHIYREGCAQSLQKWLHNN

• Full Name: CD37 antigen
• Calculated Molecular Weight: 32 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: NM_007645.4
• Gene Symbol: Cd37
• Gene ID (NCBI): 12493
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q61470
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CD37 is a membrane protein of the tetraspanin superfamily which are characterized by the presence of four conserved transmembrane regions. Many of these members are expressed on leukocytes and have been implicated in signal transduction, cell-cell interactions, and cellular activation and development. CD37 plays a role in B-cell function, and may also play a role in T-cell-B-cell interactions (PMID: 10891477).