Anti-Mouse CD37 Rabbit Recombinant Antibody, PBS Only

• 

  FC experiment of mouse splenocytes using 98443-1-RR (same clone as 98443-1-PBS)

  1x10^6 mouse splenocytes were surface stained with 0.25 ug Anti-Mouse CD37 Rabbit RecAb (98443-1-RR, Clone: 250262E4) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were then stained with CoraLite® Plus 647 Anti-Mouse CD45R (B220) (RA3-6B2) (CL647-65139, Clone: RA3-6B2). Cells were not fixed. This data was developed using the same antibody clone with 98443-1-PBS in a different storage buffer formulation.

• 

  FC experiment of mouse splenocytes using 98443-1-RR (same clone as 98443-1-PBS)

  1x10^6 mouse splenocytes were surface stained with 0.25 ug Anti-Mouse CD37 Rabbit RecAb (98443-1-RR, Clone: 250262E4) (red) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were not fixed. This data was developed using the same antibody clone with 98443-1-PBS in a different storage buffer formulation.

CD37 Uni-rAb^® Recombinant Antibody for FC

Cat No. 98443-1-PBS

Clone No.250262E4

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

Synonyms

Leukocyte antigen CD37, Tetraspanin 26, TSPAN26

---

Product Information

98443-1-PBS targets CD37 in FC applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2729

  Product name: Recombinant Mouse CD37 protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 112-241 aa of NM_007645.4

  Sequence: RVRLERRVQELVLRTIQSYRTNPDETAAEESWDYAQFQLRCCGWQSPRDWNKAQMLKANESEEPFVPCSCYNSTATNDSTVFDKLFFSQLSRLGPRAKLRQTADICALPAKAHIYREGCAQSLQKWLHNN

• Full Name: CD37 antigen
• Calculated Molecular Weight: 32 kDa
• GenBank Accession Number: NM_007645.4
• Gene Symbol: Cd37
• Gene ID (NCBI): 12493
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q61470
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CD37 is a membrane protein of the tetraspanin superfamily which are characterized by the presence of four conserved transmembrane regions. Many of these members are expressed on leukocytes and have been implicated in signal transduction, cell-cell interactions, and cellular activation and development. CD37 plays a role in B-cell function, and may also play a role in T-cell-B-cell interactions (PMID: 10891477).