Tested Applications
| Positive WB detected in | Daudi cells, Raji cells, Ramos cells |
| Positive IHC detected in | human tonsillitis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | Daudi cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 5 publications below |
| IHC | See 2 publications below |
Product Information
28158-1-AP targets CD40 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag28033 Product name: Recombinant human CD40 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 24-193 aa of BC012419 Sequence: TACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR Predict reactive species |
| Full Name | CD40 molecule, TNF receptor superfamily member 5 |
| Calculated Molecular Weight | 277 aa, 31 kDa |
| Observed Molecular Weight | 40-45 kDa |
| GenBank Accession Number | BC012419 |
| Gene Symbol | CD40 |
| Gene ID (NCBI) | 958 |
| ENSEMBL Gene ID | ENSG00000101017 |
| RRID | AB_2881078 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P25942 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Cluster of differentiation 40 (CD40) is a costimulatory protein located on antigen presenting cells and is required for their activation. CD40 is a member of the tumor necrosis factor (TNF) receptor (TNFR) family.
What is the molecular weight of CD40?
The molecular weight of CD40 is 43 kDa.
What is the cellular localization of CD40?
CD40 can be secreted by cells or found in the cell membrane.
What is the tissue specificity of CD40?
CD40 is expressed in B cells and primary carcinoma cells but is also found in dendritic cells and macrophages (PMID: 10209159).
What is the function of CD40?
CD40 acts as a receptor for TNFSF5/CD40LG, which is expressed on activated T cells. This interaction is essential for B cell proliferation, expression of activation markers, immunoglobulin production, and isotype switching (PMID: 8809473). This interaction is also crucial for the formation of memory B cells and germinal centers, and signaling through CD40 prevents apoptosis of germinal center B cells.
What is the role of CD40 in disease?
Defects in CD40 lead to hyper-IgM immunodeficiency syndrome type 3 (HIGM3) (PMID: 11675497). This is an autosomal recessive disorder that includes the inability of B cells to undergo isotype switching, a key step in the final differentiation of the humoral immune response, and an inability to mount an antibody-specific immune response.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CD40 antibody 28158-1-AP | Download protocol |
| IHC protocol for CD40 antibody 28158-1-AP | Download protocol |
| WB protocol for CD40 antibody 28158-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
J Cell Mol Med Machine learning-based identification of a cell death-related signature associated with prognosis and immune infiltration in glioma | ||
Toxicology Role of miR-145-5p/ CD40 in the inflammation and apoptosis of HUVECs induced by PM2.5. | ||
Cardiovasc Ther Bazedoxifene Plays a Protective Role against Inflammatory Injury of Endothelial Cells by Targeting CD40.
| ||
FEBS Open Bio A methylation-driven gene panel predicts survival in patients with colon cancer. | ||
Phytomedicine Effects of Rhaponticum carthamoides (Willd.) Iljin on endothelial dysfunction and the inflammatory response in type 2 diabetes mellitus mice | ||
Adv Sci (Weinh) Irisin-Encapsulated Mitochondria-Targeted Biomimetic Nanotherapeutics for Alleviating Acute Kidney Injury |







