• Featured Product
  • KD/KO Validated

CD40 Polyclonal antibody

CD40 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 28158-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, ELISA

TNFRSF5, p50, CD40L receptor, Bp50, B-cell surface antigen CD40

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inDaudi cells, Raji cells, Ramos cells
Positive IHC detected inhuman tonsillitis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inDaudi cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:8000
Immunohistochemistry (IHC)IHC : 1:1000-1:4000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

28158-1-AP targets CD40 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag28033

Product name: Recombinant human CD40 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 24-193 aa of BC012419

Sequence: TACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR

Predict reactive species
Full Name CD40 molecule, TNF receptor superfamily member 5
Calculated Molecular Weight 277 aa, 31 kDa
Observed Molecular Weight 40-45 kDa
GenBank Accession NumberBC012419
Gene Symbol CD40
Gene ID (NCBI) 958
ENSEMBL Gene IDENSG00000101017
RRIDAB_2881078
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP25942
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cluster of differentiation 40 (CD40) is a costimulatory protein located on antigen presenting cells and is required for their activation. CD40 is a member of the tumor necrosis factor (TNF) receptor (TNFR) family.

What is the molecular weight of CD40?

The molecular weight of CD40 is 43 kDa.

What is the cellular localization of CD40?

CD40 can be secreted by cells or found in the cell membrane.

What is the tissue specificity of CD40?

CD40 is expressed in B cells and primary carcinoma cells but is also found in dendritic cells and macrophages (PMID: 10209159).

What is the function of CD40?

CD40 acts as a receptor for TNFSF5/CD40LG, which is expressed on activated T cells. This interaction is essential for B cell proliferation, expression of activation markers, immunoglobulin production, and isotype switching (PMID: 8809473). This interaction is also crucial for the formation of memory B cells and germinal centers, and signaling through CD40 prevents apoptosis of germinal center B cells.

What is the role of CD40 in disease?

Defects in CD40 lead to hyper-IgM immunodeficiency syndrome type 3 (HIGM3) (PMID: 11675497). This is an autosomal recessive disorder that includes the inability of B cells to undergo isotype switching, a key step in the final differentiation of the humoral immune response, and an inability to mount an antibody-specific immune response.


Protocols

Product Specific Protocols
WB protocol for CD40 antibody 28158-1-APDownload protocol
IHC protocol for CD40 antibody 28158-1-APDownload protocol
IF protocol for CD40 antibody 28158-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIHC

J Cell Mol Med

Machine learning-based identification of a cell death-related signature associated with prognosis and immune infiltration in glioma

Authors - Quanwei Zhou
humanWB

Toxicology

Role of miR-145-5p/ CD40 in the inflammation and apoptosis of HUVECs induced by PM2.5.

Authors - Xueting Zhang
humanWB

Cardiovasc Ther

Bazedoxifene Plays a Protective Role against Inflammatory Injury of Endothelial Cells by Targeting CD40.

Authors - Wenmin Song
  • KD Validated
humanWB

FEBS Open Bio

A methylation-driven gene panel predicts survival in patients with colon cancer.

Authors - Yaojun Peng
humanIHC

Front Immunol

TANK shapes an immunosuppressive microenvironment and predicts prognosis and therapeutic response in glioma

Authors - Shasha Li
humanWB

Adv Sci (Weinh)

Irisin-Encapsulated Mitochondria-Targeted Biomimetic Nanotherapeutics for Alleviating Acute Kidney Injury

Authors - Xia Zhang
Loading...
||
New chat Able
正在加载,请稍候...